SYNJ2BP/ARIP2 Antibody

Western Blot: SYNJ2BP/ARIP2 Antibody [NBP1-88985] - Analysis in mouse cerebral cortex tissue.

Immunocytochemistry/Immunofluorescence: SYNJ2BP/ARIP2 Antibody [NBP1-88985] - Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.

Immunohistochemistry-Paraffin: SYNJ2BP/ARIP2 Antibody [NBP1-88985] - Staining of mouse parietal association cortex shows strong positivity in synapses .

Western Blot: SYNJ2BP/ARIP2 Antibody [NBP1-88985] - Analysis in human cell line RT-4.

Immunohistochemistry-Paraffin: SYNJ2BP/ARIP2 Antibody [NBP1-88985] - Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: SYNJ2BP/ARIP2 Antibody [NBP1-88985] - Staining of human kidney shows moderate granular cytoplasmic positivity in cells in distal tubules.

Immunohistochemistry-Paraffin: SYNJ2BP/ARIP2 Antibody [NBP1-88985] - Staining of human prostate shows strong granular cytoplasmic positivity in glandular cells.

Immunohistochemistry: SYNJ2BP/ARIP2 Antibody [NBP1-88985] - Staining of human testis shows moderate granular cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: SYNJ2BP/ARIP2 Antibody [NBP1-88985] - Staining of mouse globus pallidus shows weak positivity in synapses and neuronal processes.

Immunohistochemistry-Paraffin: SYNJ2BP/ARIP2 Antibody [NBP1-88985] - Staining of mouse hippocampus shows strong positivity in synapses.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

SYNJ2BP/ARIP2 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: NGRVDYLVTEEEINLTRGPSGLGFNIVGGTDQQYVSNDSGIYVSRIKENGAAALDGRLQEGDKILSVNGQDLKNLLHQDAVDLFRNAGYAVSLRVQHRLQVQNGPIGHRGEG
• Predicted Species: Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SYNJ2BP
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  SYNJ2BP/ARIP2 Protein (NBP1-88985PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SYNJ2BP/ARIP2 Antibody

• activin receptor interacting protein 5
• ARIP2
• FLJ11271
• Mitochondrial outer membrane protein 25
• OMP25FLJ41973
• synaptojanin 2 binding protein
• synaptojanin-2-binding protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SYNJ2BP/ARIP2 Antibody (NBP1-88985)(1)

Publication using NBP1-88985

• Mulder J, Bjorling E, Jonasson K et al. Tissue Profiling of the Mammalian Central Nervous System Using Human Antibody-based Proteomics. Mol Cell Proteomics 2009-07-01 [PMID: 19351664]

Bioinformatics

• Gene Symbol: SYNJ2BP