ZNHIT3 Antibody - BSA Free

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ZNHIT3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ZNHIT3 Antibody - BSA Free (NBP3-05276) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 35-100 of human ZNHIT3 (NP_004764.1). FRKHKEQCNPETRPVEKKIRSALPTKTVKPVENKDDDDSIADFLNSDEEEDRVSLQNLKNLGESAT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZNHIT3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500-1:2000
• Theoretical MW: 18 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ZNHIT3 Antibody - BSA Free

• HNF-4a coactivator
• Thyroid hormone receptor interactor 3TR-interacting protein 3
• Thyroid receptor-interacting protein 3
• TRIP-3
• TRIP3thyroid receptor interacting protein 3
• zinc finger HIT domain-containing protein 3
• zinc finger, HIT domain containing 3
• zinc finger, HIT type 3
• zinc finger, HIT-type containing 3

Background

ZNHIT3/TRIP3 interacts with HNF-4 alpha, a transcription factor involved in glucose metabolism. As a protein associated with HNF-4, ZNHIT3/TRIP3 functions as a transcriptional coactivator. Alternate names for ZNHIT3/TRIP3 include Zinc finger HIT domain-containing protein 3, thyroid receptor-interacting protein 3, and HNF4a coactivator.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZNHIT3