ZNF537 Antibody

Images

 
Western Blot: ZNF537 Antibody [NBP2-83864] - Host: Rabbit. Target Name: Tshz2. Sample Type: Mouse Liver lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZNF537 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of mouse ZNF537. Peptide sequence: VARHYLFENTDQPIDLTKSKSKRAESSQAQSCTSPPQKHALCDIADMVKV The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
TSHZ3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZNF537 Antibody

  • FLJ54422
  • KIAA1474
  • teashirt 3
  • teashirt zinc finger homeobox 3
  • zinc finger protein 537
  • ZNF537

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

314-BP/CF
Species: Hu
Applications: BA, BA
NBP1-88303
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87377
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-90012
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-56510
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
MAB4028
Species: Hu, Mu
Applications: WB
423-F8
Species: Hu, Mu
Applications: BA
1845-SH/CF
Species: Hu
Applications: BA
NBP1-47945
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-56511
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, WB
MAB1675
Species: Ch, Hu, Mu, Rt
Applications: ICC, IHC
NB110-58360
Species: Hu, Mu, Rt
Applications: IP, WB
NBP3-07598
Species: Hu
Applications: Flow, ICC/IF, PA
NBP2-94348
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP2-61879
Species: Hu, Mu
Applications: ELISA, Flow, IHC, IHC-P, WB
NB120-10454
Species: Bv, Hu, Mu, Rt
Applications: ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, MiAr, WB
MAB2476
Species: Hu
Applications: IHC, WB
NB100-598
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IP, WB
NBP2-48736
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-83864
Species: Mu
Applications: WB

Publications for ZNF537 Antibody (NBP2-83864) (0)

There are no publications for ZNF537 Antibody (NBP2-83864).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF537 Antibody (NBP2-83864) (0)

There are no reviews for ZNF537 Antibody (NBP2-83864). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF537 Antibody (NBP2-83864) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZNF537 Products

Bioinformatics Tool for ZNF537 Antibody (NBP2-83864)

Discover related pathways, diseases and genes to ZNF537 Antibody (NBP2-83864). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF537 Antibody (NBP2-83864)

Discover more about diseases related to ZNF537 Antibody (NBP2-83864).
 

Pathways for ZNF537 Antibody (NBP2-83864)

View related products by pathway.

PTMs for ZNF537 Antibody (NBP2-83864)

Learn more about PTMs related to ZNF537 Antibody (NBP2-83864).

Blogs on ZNF537

There are no specific blogs for ZNF537, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF537 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TSHZ3