ZNF423 Antibody

Images

 
Western Blot: ZNF423 Antibody [NBP1-80329] - Titration: 0.2-1 ug/ml, Positive Control: HT1080 cell lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZNF423 Antibody Summary

Immunogen
Synthetic peptide directed towards the middle region of human ZNF423. Peptide sequence CFTVFVQANKLQQHIFAVHGQEDKIYDCSQCPQKFFFQTELQNHTMSQHA.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF423
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against ZNF423 and was validated on Western blot.
Theoretical MW
144 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ZNF423 Antibody

  • FLJ20086
  • KIAA1584
  • MGC21637
  • MGC61687
  • SUHW4
  • Suppressor of hairy wing homolog 4
  • zinc finger protein 280D
  • Zinc finger protein 634
  • ZNF634suppressor of hairy wing homolog 4 (Drosophila)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5165
Species: Hu, Mu
Applications: WB
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-32887
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, PAGE, IF
355-BM/CF
Species: Hu, Mu, Rt
NBP2-45808
Species: Hu
Applications: IHC
NB100-56656
Species: Hu, Mu, Rt
Applications: WB
AF2097
Species: Hu
Applications: WB, ChIP, ICC
NBP1-91270
Species: Hu, Mu
Applications: WB (-), ICC/IF, IHC, IHC-P
AF5869
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IP, ICC
NB200-322
Species: Hu, Mu, Rt
Applications: WB, IHC-Fr
H00010798-R02
Species: Hu
NB100-142
Species: Hu, Mu, Rt, Ch, Ha
Applications: WB, Simple Western, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF7006
Species: Hu, Mu
Applications: WB, IHC
NB100-56440
Species: Hu, Mu, Rt, Pm, Sh
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB110-41622
Species: Hu, Mu, Rt, Po, Bv, Ch, Gt, Xp
Applications: WB, IHC, IHC-P
NBP1-88837
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-155
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-80329
Species: Hu
Applications: WB

Publications for ZNF423 Antibody (NBP1-80329) (0)

There are no publications for ZNF423 Antibody (NBP1-80329).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF423 Antibody (NBP1-80329) (0)

There are no reviews for ZNF423 Antibody (NBP1-80329). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF423 Antibody (NBP1-80329) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZNF423 Products

Bioinformatics Tool for ZNF423 Antibody (NBP1-80329)

Discover related pathways, diseases and genes to ZNF423 Antibody (NBP1-80329). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF423 Antibody (NBP1-80329)

Discover more about diseases related to ZNF423 Antibody (NBP1-80329).
 

Pathways for ZNF423 Antibody (NBP1-80329)

View related products by pathway.

Blogs on ZNF423

There are no specific blogs for ZNF423, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF423 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF423
Uniprot