ZNF41 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: ZNF41 Antibody [NBP2-49585] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm.

Immunohistochemistry-Paraffin: ZNF41 Antibody [NBP2-49585] - Staining in human thyroid gland and pancreas tissues using anti-ZNF41 antibody. Corresponding ZNF41 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: ZNF41 Antibody [NBP2-49585] - Staining of human cerebral cortex shows moderate nuclear positivity in neuronal cells.

Immunohistochemistry-Paraffin: ZNF41 Antibody [NBP2-49585] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry-Paraffin: ZNF41 Antibody [NBP2-49585] - Staining of human thyroid gland shows high expression.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ZNF41 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ZNF41 Antibody - BSA Free (NBP2-49585) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: RIHAGEKSRECDKSNKVFPQKPQVDVHPSVYTGEKPY
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZNF41
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ZNF41 Recombinant Protein Antigen (NBP2-49585PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ZNF41 Antibody - BSA Free

• zinc finger protein 296
• Zinc finger protein 342ZFP296ZNF342

Background

ZNF41 product is a likely zinc finger family transcription factor. It contains KRAB-A and KRAB-B domains that act as transcriptional repressors in related proteins, and multiple zinc finger DNA binding motifs and finger linking regions characteristic of the Kruppel family. This gene is part of a gene cluster on chromosome Xp11.23. Several alternatively spliced transcript variants have been described, however, the full-length nature of only some of them is known.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZNF41