ZNF182 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ZNF182 Antibody [NBP2-32480] - Immunofluorescent staining of human cell line SiHa shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: ZNF182 Antibody [NBP2-32480] - Staining of human kidney shows weak cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZNF182 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: YSNLVFVGQQVTKPNLILKLEVEECPAEGKIPFWNFPEVCQVDE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF182
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZNF182 Protein (NBP2-32480PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZNF182 Antibody

  • HHZ150
  • KOX14zinc finger protein 182 (HHZ150)
  • MGC131713
  • Zfp182
  • zinc finger protein 182
  • zinc finger protein 21 (KOX 14)
  • Zinc finger protein 21
  • Zinc finger protein KOX14
  • ZNF21MGC125383

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-79990
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-49585
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-13412
Species: Hu
Applications: WB, IHC, IHC-P
NB300-104
Species: Hu, Mu, Rt, Bv, GP, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IP, IHC-FrFl
NBP2-46538
Species: Hu
Applications: WB, IHC
NBP2-13555
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
PPS021
Species: Hu, Mu, Rt, Ca, Pm, Ze
Applications: WB
NBP1-80584
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00023415-R03
Species: Hu
NBP1-30646
Species: Hu
Applications: WB, IHC, IHC-P
NB600-261
Species: Hu, Mu
Applications: WB, ChIP, Flow, IP
NBP2-13577
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57508
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NBP1-80582
Species: Hu
Applications: IHC, IHC-P
NB100-116
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA
NBP2-32480
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for ZNF182 Antibody (NBP2-32480) (0)

There are no publications for ZNF182 Antibody (NBP2-32480).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF182 Antibody (NBP2-32480) (0)

There are no reviews for ZNF182 Antibody (NBP2-32480). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ZNF182 Antibody (NBP2-32480) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZNF182 Products

Bioinformatics Tool for ZNF182 Antibody (NBP2-32480)

Discover related pathways, diseases and genes to ZNF182 Antibody (NBP2-32480). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF182 Antibody (NBP2-32480)

Discover more about diseases related to ZNF182 Antibody (NBP2-32480).
 

Pathways for ZNF182 Antibody (NBP2-32480)

View related products by pathway.

Blogs on ZNF182

There are no specific blogs for ZNF182, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF182 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF182