ZNF398 Antibody - BSA Free

Western Blot: ZNF398 Antibody [NBP2-88680] - WB Suggested Anti-ZNF398 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: 293T cell lysate

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

ZNF398 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ZNF398 Antibody - BSA Free (NBP2-88680) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZNF398. Peptide sequence: NLSQDMLLTHQCSHATEHPLPCAQCPKHFTPQADLSSTSQDHASETPPTC The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZNF398
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for ZNF398 Antibody - BSA Free

• KIAA0961zinc finger protein 30 homolog
• zfp-30
• zinc finger protein 30 homolog (mouse)
• Zinc finger protein 745
• ZNF745Zfp-30

Background

ZNF398 encodes a member of the Kruppel family of C2H2-type zinc-finger transcription factor proteins. The encoded protein acts as a transcriptional activator. Two transcript variants encoding distinct isoforms have been identified for this gene. Other transcript variants have been described, but their full length sequence has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZNF398