ZNF367 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ZNF367 Antibody [NBP2-58701] - Staining of human cell line U-251 MG shows localization to nucleoplasm.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZNF367 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RHCPKHPYARLKREEPTDTLSKHQAADNKAAAEWLARYWEMREQRTPTLKGKLVQKADQEQQDPLEYLQSDEEDDEKRGAQRRLQEQRERLHGALALIELANLTG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF367
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for ZNF367 Antibody

  • C2H2 zinc finger protein ZFF29
  • CDC14B
  • ZFF29
  • zinc finger protein 367

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB4457
Species: Hu, Mu, Rt
Applications: WB
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-15840
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-464
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PLA
AF4885
Species: Mu
Applications: WB, IP
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB100-1923
Species: Ce
Applications: WB, IHC, IHC-P, IP
NB100-547
Species: Hu
Applications: WB, ICC/IF, IP, PLA
AF1555
Species: Hu
Applications: WB
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89917
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-15141
Species: Hu
Applications: WB
AF6817
Species: Hu
Applications: WB
NBP2-47560
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58701
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for ZNF367 Antibody (NBP2-58701) (0)

There are no publications for ZNF367 Antibody (NBP2-58701).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF367 Antibody (NBP2-58701) (0)

There are no reviews for ZNF367 Antibody (NBP2-58701). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ZNF367 Antibody (NBP2-58701) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZNF367 Products

ZNF367 NBP2-58701

Bioinformatics Tool for ZNF367 Antibody (NBP2-58701)

Discover related pathways, diseases and genes to ZNF367 Antibody (NBP2-58701). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on ZNF367

There are no specific blogs for ZNF367, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF367 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF367