Apolipoprotein C1 Antibody (2E2-1A3)

Images

 
Western Blot: Apolipoprotein C1 Antibody (2E2-1A3) [H00000341-M01] - Analysis of APOC1 expression in transfected 293T cell line by APOC1 monoclonal antibody (M01), clone 2E2-1A3.Lane 1: APOC1 transfected lysate(9 ...read more
Western Blot: Apolipoprotein C1 Antibody (2E2-1A3) [H00000341-M01] - APOC1 monoclonal antibody (M01), clone 2E2-1A3. Analysis of APOC1 expression in human liver.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, Flow, Func
Clone
2E2-1A3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Apolipoprotein C1 Antibody (2E2-1A3) Summary

Immunogen
APOC1 (AAH09698, 1 a.a. ~ 83 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MRLFLSLPVLVVVLSIVLEGPAPAQGTPDVSSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSETFQKVKEKLKIDS
Localization
Secreted.
Specificity
APOC1 - apolipoprotein C-I
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
APOC1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Flow Cytometry
  • Functional
  • Western Blot 1:500
Application Notes
Antibody reactivity against tissue lysate, transfected lysate and recombinant protein for WB. It has been used for Sandwich ELISA.
Publications
Read Publications using H00000341-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Apolipoprotein C1 Antibody (2E2-1A3)

  • APOC1
  • APOC1B
  • Apo-CIB
  • ApoC-IB
  • Apolipoprotein C1
  • apolipoprotein C-I

Background

The protein encoded by this gene is a member of the apolipoprotein C1 family. This gene is expressed primarily in the liver, and it is activated when monocytes differentiate into macrophages. A pseudogene of this gene is located 4 kb downstream in the same orientation, on the same chromosome. This gene is mapped to chromosome 19, where it resides within a apolipoprotein gene cluster. Alternatively spliced transcript variants have been found for this gene, but the biological validity of some variants has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-60531
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, WB
AF4497
Species: Hu
Applications: Simple Western, WB
NBP2-92734
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-92172
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-52979
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF7197
Species: Hu, Mu
Applications: ICC, IHC, WB
NBP2-75410
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-34294
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
NBP1-78159
Species: Bv, Hu, Po, Rt
Applications: EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, PLA, RIA, WB
NB300-558
Species: Bv, Hu, Rb
Applications: ELISA, ICC/IF, IP, WB
NBP2-67656
Species: Hu, Mu, Rt, Ze
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP2-19860
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-93935
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP1-88527
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-78162
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB200-527
Species: Hu, Mu, Rt
Applications: IP, WB
H00000341-M01
Species: Hu
Applications: WB, ELISA, Flow, Func

Publications for Apolipoprotein C1 Antibody (H00000341-M01)(3)

Reviews for Apolipoprotein C1 Antibody (H00000341-M01) (0)

There are no reviews for Apolipoprotein C1 Antibody (H00000341-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Apolipoprotein C1 Antibody (H00000341-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Apolipoprotein C1 Products

Bioinformatics Tool for Apolipoprotein C1 Antibody (H00000341-M01)

Discover related pathways, diseases and genes to Apolipoprotein C1 Antibody (H00000341-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Apolipoprotein C1 Antibody (H00000341-M01)

Discover more about diseases related to Apolipoprotein C1 Antibody (H00000341-M01).
 

Pathways for Apolipoprotein C1 Antibody (H00000341-M01)

View related products by pathway.

PTMs for Apolipoprotein C1 Antibody (H00000341-M01)

Learn more about PTMs related to Apolipoprotein C1 Antibody (H00000341-M01).
 

Research Areas for Apolipoprotein C1 Antibody (H00000341-M01)

Find related products by research area.

Blogs on Apolipoprotein C1

There are no specific blogs for Apolipoprotein C1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Apolipoprotein C1 Antibody (2E2-1A3) and receive a gift card or discount.

Bioinformatics

Gene Symbol APOC1
Entrez
OMIM
Uniprot