ZIC1 Antibody - Azide and BSA Free

Western Blot: ZIC1 Antibody [NBP2-94229] - Analysis of extracts of various cell lines, using ZIC1 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 30s.

• Reactivity: Hu, Mu, Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

ZIC1 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit ZIC1 Antibody - Azide and BSA Free (NBP2-94229) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 120-210 of human ZIC1 (NP_003403.2). LFAASAGGFGGPHGHTDAAGHLLFPGLHEQAAGHASPNVVNGQMRLGFSGDMYPRPEQYGQVTSPRSEHYAAPQLHGYGPMNVNMAAHHGA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZIC1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500-1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for ZIC1 Antibody - Azide and BSA Free

• Zic family member 1 (odd-paired homolog, Drosophila)
• ZIC1
• ZICZic family member 1 (odd-paired Drosophila homolog)
• Zinc finger protein 201
• Zinc finger protein of the cerebellum 1
• ZNF201
• ZNF201zinc finger protein ZIC 1

Background

The Zic-1 gene, which encodes a zinc finger protein, is expressed in the developing or matured central nervous system in a highly restricted manner. The Zic gene is expressed in granule cells that make synaptic contact with Purkinje cells. Clearly Zic-1 is a gene critical to cerebellar pattern formation. The expression of Zic genes is first detected at gastrulation and at neurulation, becomes restricted to the dorsal neural ectoderm and the dorsal paraxial mesoderm. Zic-2 and Zic-3 are highly similar genes, especially in their product's zinc finger motif and by comparison of their genomic organization in that they share common exon-intron boundaries and belong to the same gene family. By comparison in function, Zic-2 is essential for the formation of the brain and Zic-3 is important for right and left axis formation. The Zic-1 gene has been mapped to chromosome 9 in mouse. The 5' flanking region of the Zic-1 gene contains a region-specific enhancer determined to be essential in in vivo and in vitro deletion analysis. The temporal profile of mRNA expression differs for each of the Zic gene products. The Drosophila odd-paired gene is highly homologous to the Zic gene family.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: ZIC1