ZIC5 Antibody - BSA Free

Western Blot: ZIC5 Antibody [NBP2-84346] - WB Suggested Anti-ZIC5 Antibody Titration: 0.125ug/ml. Positive Control: Human cerebellum

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

ZIC5 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ZIC5 Antibody - BSA Free (NBP2-84346) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human ZIC5. Peptide sequence: MEPPLSKRNPPALRLADLATAQVQPLQNMTGFPALAGPPAHSQLRAAVAH The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZIC5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for ZIC5 Antibody - BSA Free

• Zic family member 5 (odd-paired homolog, Drosophila)
• zinc family member 5 protein
• Zinc finger protein of the cerebellum 5
• zinc finger protein ZIC 5

Background

The ZIC5 gene encodes a member of the ZIC family of C2H2-type zinc finger proteins. Members of this family are importantduring development, and have been associated X-linked visceral heterotaxy and holoprosencephaly type 5. This gene isclosely linked to a gen

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZIC5