Zhangfei Antibody - Azide and BSA Free

Western Blot: Zhangfei Antibody [NBP2-94859] - Analysis of extracts of various cell lines, using Zhangfei .Exposure time: 1s.

SMILE and MITF are reciprocally regulated by alpha -MSH in B16F10 mouse melanoma cells. Cells were treated with 1 uM alpha -MSH in a time-dependent manner. (a) Protein levels of MITF, melanogenic enzymes, and SMILE. (b) mRNA levels of genes encoding SMILE and MITF. * p < 0.05 vs. no treatment of alpha -MSH by one-way ANOVA. Image collected and cropped by CiteAb from the following open publication (//pubmed.ncbi.nlm.nih.gov/36499416), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

SMILE overexpression downregulates the expression of melanogenic genes in B16F10 cells. Cells were infected with Ad-GFP or Ad-SMILE for 48 h and then, treated with 1 uM alpha -MSH for 1 h or 24 h. (a) Melanin contents. (b) Cellular tyrosinase activity. (c) mRNA levels of melanogenic genes. (d) Protein levels of SMILE and melanogenic genes. Data are mean +/- SEM. * p < 0.05 vs. Ad-GFP; #p < 0.05 vs. Ad-GFP + alpha -MSH by one-way ANOVA (a). * p < 0.05 vs. Ad-GFP (b,c) by Student’s t-test. Image collected and cropped by CiteAb from the following open publication (//pubmed.ncbi.nlm.nih.gov/36499416), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

• Reactivity: Hu, Mu, Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Zhangfei Antibody - Azide and BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-354 of human CREBZF (NP_001034707.1). MRHSLTKLLAASGSNSPTRSESPEPAATCSLPSDLTRAAAGEEETAAAGSPGRKQQFGDEGELEAGRGSRGGVAVRAPSPEEMEEEAIASLPGEETEDMDFLSGLELADLLDPRQPDWHLDPGLSSPGPLSSSGGGSDSGGLWRGDDDDEAAAAEMQRFSDLLQRLLNGIGGCSSSSDSGSAEKRRRKSPGGGGGGGSGNDNNQAATKSPRKAAAAAARLNRLKKKEYVMGLESRVRGLAAENQELRAENRELGKRVQALQEESRYLRAVLANETGLARLLSRLSGVGLRLTTSLFRDSPAGDHDYALPVGKQKQDLLEEDDSAGGVCLHVDKDKVSVEFCSACARKASSSLKM
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CREBZF
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500-1:2000
• Theoretical MW: 37 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for Zhangfei Antibody - Azide and BSA Free

• CREB/ATF bZIP transcription factor
• FLJ94018
• HCF-binding transcription factor Zhangfei
• Host cell factor-binding transcription factor Zhangfei
• SHP-interacting leucine zipper protein
• SMILE
• Zhangfei

Background

Strongly activates transcription when bound to HCFC1. Suppresses the expression of HSV proteins in cellsinfected with the virus in a HCFC1-dependent manner. Also suppresses the HCFC1-dependent transcriptional activation byCREB3 and reduces the amount of CREB3 in the cell. Able to down-regulate expression of some cellular genes inCREBZF-expressing cells

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

&#9888; WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: CREBZF