ZFP57 Antibody

Images

 
Western Blot: ZFP57 Antibody [NBP1-91550] - Jurkat cell lysate, Antibody Titration: 1.25ug/ml
Immunohistochemistry-Paraffin: ZFP57 Antibody [NBP1-91550] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZFP57 Antibody Summary

Immunogen
Synthetic peptide directed towards the N terminal of human ZFP57. Peptide sequence MFEQLKPIEPRDCWREARVKKKPVTFEDVAVNFTQEEWDCLDASQRVLYQ.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZFP57
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against ZFP57 and was validated on Western Blot and immunohistochemistry.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ZFP57 Antibody

  • C6orf40
  • TNDM1
  • zfp-57
  • zinc finger protein 57 homolog (mouse)
  • zinc finger protein 698
  • ZNF698

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2350
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-01245
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NBP2-61838
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
44230002
Species: Hu
Applications: WB, ELISA
NB100-86989
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-49601
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20439
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00388112-B01P
Species: Hu
Applications: WB, ELISA
NBP2-39076
Species: Hu
Applications: IHC, IHC-P
NBP2-20322
Species: Hu
Applications: WB, IP, ChIP, ICC
AF1997
Species: Hu
Applications: WB, ChIP, ICC
MAB1799
Species: Hu, Mu, Rt
Applications: WB, IP, ICC, ICFlow, KO
NBP2-14093
Species: Hu
Applications: WB, IHC, IHC-P
H00003126-M01
Species: Hu
Applications: WB, ELISA, IHC-P
H00002158-M01
Species: Hu
Applications: WB, ELISA, IP, RNAi
NBP1-91550
Species: Hu
Applications: WB, IHC, IHC-P

Publications for ZFP57 Antibody (NBP1-91550) (0)

There are no publications for ZFP57 Antibody (NBP1-91550).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZFP57 Antibody (NBP1-91550) (0)

There are no reviews for ZFP57 Antibody (NBP1-91550). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZFP57 Antibody (NBP1-91550) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Array NBP1-91550

Bioinformatics Tool for ZFP57 Antibody (NBP1-91550)

Discover related pathways, diseases and genes to ZFP57 Antibody (NBP1-91550). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZFP57 Antibody (NBP1-91550)

Discover more about diseases related to ZFP57 Antibody (NBP1-91550).
 

Pathways for ZFP57 Antibody (NBP1-91550)

View related products by pathway.

PTMs for ZFP57 Antibody (NBP1-91550)

Learn more about PTMs related to ZFP57 Antibody (NBP1-91550).

Blogs on ZFP57

There are no specific blogs for ZFP57, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZFP57 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZFP57
Uniprot