ZNF331 Antibody - Azide and BSA Free

Western Blot: ZNF331 Antibody [H00055422-B01P] - Analysis of ZNF331 expression in transfected 293T cell line by ZNF331 polyclonal antibody. Lane 1: ZNF331 transfected lysate(50.93 KDa). Lane 2: Non-transfected lysate.

Immunocytochemistry/Immunofluorescence: ZNF331 Antibody [H00055422-B01P] - Analysis of purified antibody to ZNF331 on HeLa cell. (antibody concentration 10 ug/ml)

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

ZNF331 Antibody - Azide and BSA Free Summary

• Immunogen: ZNF331 (AAH09433.1, 1 a.a. - 463 a.a.) full-length human protein. MAQGLVTFADVAIDFSQEEWACLNSAQRDLYWDVMLENYSNLVSLDLESAYENKSLPTKKNIHEIRASKRNSDRRSKSLGRNWICEGTLERPQRSRGRYVNQMIINYVKRPATREGTPPRTHQRHHKENSFECKDCGKAFSRGYQLSQHQKIHTGEKPYECKECKKAFRWGNQLTQHQKIHTGEKPYECKDCGKAFRWGSSLVIHKRIHTGEKPYECKDCGKAFRRGDELTQHQRFHTGEKDYECKDCGKTFSRVYKLIQHKRIHSGEKPYECKDCGKAFICGSSLIQHKRIHTGEKPYECQECGKAFTRVNYLTQHQKIHTGEKPHECKECGKAFRWGSSLVKHERIHTGEKPYKCTECGKAFNCGYHLTQHERIHTGETPYKCKECGKAFIYGSSLVKHERIHTGVKPYGCTECGKSFSHGHQLTQHQKTHSGAKSYECKECGKACNHLNHLREHQRIHNS
• Specificity: ZNF331 - zinc finger protein 331,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: ZNF331
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot 1:500
• Application Notes: Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. It has also been used for immunofluorescence.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ZNF331 Antibody - Azide and BSA Free

• ZFN533
• zinc finger protein 385B
• Zinc finger protein 533FLJ25270
• ZNF533

Background

Zinc finger proteins have been shown to interact with nucleic acids and to have diverse functions. The zinc finger domain is a conserved amino acid sequence motif containing 2 specifically positioned cysteines and 2 histidines that are involved in coordinating zinc. Kruppel-related proteins form one family of zinc finger proteins. See ZFP93 (MIM 604749) for additional information on zinc finger proteins.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZNF331
• Entrez:
  • 55422(Human)
• Uniprot:
  • AAH09433.1(Human)