ZBTB20 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ZBTB20 Antibody [NBP1-84146] - Staining of human cell line U-251 MG shows localization to nucleoplasm & nuclear bodies.
Immunohistochemistry-Paraffin: ZBTB20 Antibody [NBP1-84146] - Staining of human kidney shows strong nuclear positivity in tubule cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZBTB20 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SVEQQFGPGAARDSQAEPTQPEQAAEAPAEGGPQTNQLETGASSPERSNEVEMDSTVITVSNSSDKSVLQQPSVNTSIGQPLPSTQLYLRQTETLTSNLRMPLTLTSNTQVIGTAGNTYLPALFTTQPAGSGPKPFLFSLPQPLAGQQTQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZBTB20
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence fixation permeabilization: PFA/Triton X-100
Control Peptide
ZBTB20 Protein (NBP1-84146PEP)
Publications
Read Publications using NBP1-84146.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZBTB20 Antibody

  • BTB/POZ zinc finger protein DPZF
  • dendritic cell-derived BTB/POZ zinc finger
  • Dendritic-derived BTB/POZ zinc finger protein
  • DPZFZinc finger protein 288ZNF288DKFZp566F123
  • FLJ26458
  • HOF
  • ODA-8S
  • zinc finger and BTB domain containing 20
  • zinc finger and BTB domain-containing protein 20

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2180
Species: Hu
Applications: WB, Simple Western, IP
MAB1368
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow, KO
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP1-84721
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-31369
Species: Hu
Applications: WB, IHC, IHC-P
AF2944
Species: Hu
Applications: WB, Simple Western
AF2185
Species: Hu, Mu, Rt
Applications: WB, IP
NBP1-83910
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-836
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-2600
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NB120-7164
Species: Hu, Mu, Rt, Fi
Applications: ELISA, ICC/IF, IHC-Fr, MiAr
NBP2-27398
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC-Fr, IHC-P, IP
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
AF5540
Species: Mu
Applications: WB

Publications for ZBTB20 Antibody (NBP1-84146)(2)

Reviews for ZBTB20 Antibody (NBP1-84146) (0)

There are no reviews for ZBTB20 Antibody (NBP1-84146). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ZBTB20 Antibody (NBP1-84146) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZBTB20 Products

Bioinformatics Tool for ZBTB20 Antibody (NBP1-84146)

Discover related pathways, diseases and genes to ZBTB20 Antibody (NBP1-84146). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZBTB20 Antibody (NBP1-84146)

Discover more about diseases related to ZBTB20 Antibody (NBP1-84146).
 

Pathways for ZBTB20 Antibody (NBP1-84146)

View related products by pathway.

PTMs for ZBTB20 Antibody (NBP1-84146)

Learn more about PTMs related to ZBTB20 Antibody (NBP1-84146).

Blogs on ZBTB20

There are no specific blogs for ZBTB20, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZBTB20 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZBTB20