YME1L1 Antibody - BSA Free

Western Blot: YME1L1 Antibody [NBP2-86396] - Host: Rabbit. Target Name: FTSH. Sample Type: SH-SYSY Whole cell lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

YME1L1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit YME1L1 Antibody - BSA Free (NBP2-86396) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human YME1L1. Peptide sequence: SDFDNATKIAKRMVTKFGMSEKLGVMTYSDTGKLSPETQSAIEQEIRILL The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: YME1L1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for YME1L1 Antibody - BSA Free

• ATP-dependent metalloprotease FtsH1 homolog
• ATP-dependent metalloprotease FtsH1
• ATP-dependent metalloprotease YME1L1
• EC 3.4.24
• EC 3.4.24.-
• FTSH
• FTSH1
• MEG4
• Meg-4
• PAMPATP-dependent zinc metalloprotease YME1L1
• Presenilin-associated metalloprotease
• YME1 (S.cerevisiae)-like 1
• YME1-like 1 (S. cerevisiae)
• YME1-like protein 1
• YME1Lmeg-4

Background

The protein encoded by the YME1L1 gene is the human ortholog of yeast mitochondrial AAA metalloprotease, Yme1p. It is localized in the mitochondria and can functionally complement a yme1 disruptant yeast strain. It is proposed that this gene plays a role in mitochondrial protein metabolism and could be involved in mitochondrial pathologies. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: YME1L1