XPG Recombinant Protein Antigen

Images

 
There are currently no images for XPG Protein (NBP2-47578PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

XPG Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ERCC5.

Source: E. coli

Amino Acid Sequence: EKEFELLDKAKRKTQKRGITNTLEESSSLKRKRLSDSKRKNTCGGFLGETCLSESSDGSSSEDAESSSLMNVQRRTAAKEPKTSASDSQNSVKEAPVK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ERCC5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-47578.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for XPG Recombinant Protein Antigen

  • COFS3
  • DNA excision repair protein ERCC-5
  • DNA repair protein complementing XP-G cells
  • EC 3.1
  • ERCM2
  • excision repair cross-complementing rodent repair deficiency, complementationgroup 5
  • excision repair protein
  • xeroderma pigmentosum complementation group G protein
  • Xeroderma pigmentosum group G-complementing protein
  • xeroderma pigmentosum, complementation group G
  • XPGC
  • XPG-complementing protein
  • XPGUVDR

Background

Excision repair cross-complementing rodent repair deficiency, complementation group 5 (xeroderma pigmentosum, complementation group G) is involved in excision repair of UV-induced DNA damage. Mutations cause Cockayne syndrome, which is characterized by severe growth defects, mental retardation, and cachexia. Multiple alternatively spliced transcript variants encoding distinct isoforms have been described, but the biological validity of all variants has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-15704
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-01020
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB100-61060
Species: Hu, Mu, Rb, V-Vi
Applications: ChIP, IP, WB
NB100-477
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
AF3416
Species: Hu
Applications: WB
NB500-704
Species: ChHa, Hu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-74457
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP1-32405
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
H00002965-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, KD, S-ELISA, WB
NBP3-46159
Species: Hu, Mu, Rt
Applications: ELISA, IHC
NBP3-07348
Species: Hu
Applications: Flow, ICC/IF, PA
NBP2-87539
Species: Hu
Applications: IHC,  IHC-P, WB
H00002968-B01P
Species: Hu
Applications: ICC/IF, WB
NB100-150
Species: Hu, Mu
Applications: ChIP, ICC/IF, IP, Simple Western, WB
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
NB100-116
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ELISA, GS, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, PLA, Simple Western, WB
NBP1-87154
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP2-16019
Species: Hu
Applications: IHC,  IHC-P, WB
NB100-165
Species: Dr, Ha, Hu
Applications: ICC/IF (-), IP, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB

Publications for XPG Protein (NBP2-47578PEP) (0)

There are no publications for XPG Protein (NBP2-47578PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for XPG Protein (NBP2-47578PEP) (0)

There are no reviews for XPG Protein (NBP2-47578PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for XPG Protein (NBP2-47578PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional XPG Products

Research Areas for XPG Protein (NBP2-47578PEP)

Find related products by research area.

Blogs on XPG.

PCNA (Proliferating cell nuclear antigen, polymerase delta auxiliary protein)
PCNA is a nuclear protein essential for DNA replication as well as DNA excision and mismatch repair pathways. It coordinates the recruitment and association of needed components during both of these processes, both of which are essential for cell cycl...  Read full blog post.

PCNA Antibodies: Marking Cell Proliferation & DNA Replication
Proliferating Cell Nuclear Antigen (PCNA), also known as the polymerase delta auxiliary protein, is a nuclear protein essential for DNA replication as well as DNA excision and mismatch repair pathways. It has a large role in cell cycle regulation and ...  Read full blog post.

Using PCNA as an Antibody Marker
PCNA antibodies are useful biomarkers in DNA repair studies. PCNA is one of several proteins essential for the completion of nucleotide excision repair, a multi-stage process involving 20 - 30 proteins, and an important factor in repairing damage and ...  Read full blog post.

NER Antibodies in Cancer Research
We at Novus Biologicals have over 230 products in our antibody catalog devoted to nucleotide excision repair. NER is a multi-stage sequential process involving over 30 proteins, all of which have been widely studied. Being the primary method to repair...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our XPG Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ERCC5