Home » XPG » XPG Proteins » XPG Recombinant Protein Antigen

XPG Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for XPG Protein (NBP2-47578PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

XPG Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ERCC5.

Source: E.coli

Amino Acid Sequence: EKEFELLDKAKRKTQKRGITNTLEESSSLKRKRLSDSKRKNTCGGFLGETCLSESSDGSSSEDAESSSLMNVQRRTAAKEPKTSASDSQNSVKEAPVK
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ERCC5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-47578.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for XPG Recombinant Protein Antigen

  • COFS3
  • DNA excision repair protein ERCC-5
  • DNA repair protein complementing XP-G cells
  • EC 3.1
  • ERCM2
  • excision repair cross-complementing rodent repair deficiency, complementationgroup 5
  • excision repair protein
  • xeroderma pigmentosum complementation group G protein
  • Xeroderma pigmentosum group G-complementing protein
  • xeroderma pigmentosum, complementation group G
  • XPGC
  • XPG-complementing protein
  • XPGUVDR

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

XPD Antibody
AF3296
Western blot shows lysates of K562 human chronic myelogenous leukemia cell line, CH-1 mouse B cell lymphoma cell line, and Rat-2 rat embryonic fibroblast cell line. PVDF membrane was probed with 0.5 µg/mL of Human/Mouse/Rat XPD Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3296) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for XPD at approximately 100 kDa (as indicated). This experiment was conducted using Immunoblot Buffer Group 1.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB
XPF Antibody
(OTI4E11) - Azide and ...
NBP2-74883
Western Blot: XPF Antibody (OTI4E11) - Azide and BSA Free [NBP2-74883] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY XPF (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-XPF.
Immunocytochemistry/Immunofluorescence: XPF Antibody (OTI4E11) - Azide and BSA Free [NBP2-74883] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY XPF.
Immunohistochemistry: XPF Antibody (OTI4E11) - Azide and BSA Free [NBP2-74883] - Staining of paraffin-embedded Human prostate tissue using anti-XPF mouse monoclonal antibody.
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, CyTOF-ready
XPB Antibody
NB100-61060
Western Blot: XPB Antibody [NB100-61060] - Whole cell lysate (15 ug) from HeLa, 293T, Jurkat, mouse TCMK-1, and mouse NIH3T3 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit antiERCC3 antibody used for WB at 0.1 ug/mL. Detection: Chemiluminescence with an exposure time of 3 minutes.
Immunoprecipitation: XPB Antibody [NB100-61060] - Detection of human ERCC3 by western blot of immunoprecipitates. Samples: Whole cell lysate (1.0 mg per IP reaction; 20% of IP loaded) from HEK293T cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-ERCC3 antibody NB100-61060 used for IP at 3 ug per reaction. ERCC3 was also immunoprecipitated by rabbit anti-ERCC3 antibody NB100-61059. For blotting immunoprecipitated ERCC3, NB100-61060 was used at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
Immunoprecipitation: XPB Antibody [NB100-61060] - Detection of human ERRC3 by western blot of immunoprecipitates. Samples: Whole cell lysate (1.0 mg per IP reaction; 20% of IP loaded) from HEK293T cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-ERRC3 antibody NB100-61059 used for IP at 3 ug per reaction. ERRC3 was also immunoprecipitated by rabbit anti-ERRC3 antibody NB100-61060. For blotting immunoprecipitated ERRC3, NB100-61060 was used at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
(1 Review)
(2 Publications)
Species: Hu, Mu, V-Vi
Applications: WB, ChIP, IP
XPC Antibody (3.26)
NB100-477
Western Blot: XPC Antibody (3.26) [NB100-477] - DNA repair protein expression in tumors. A. Western blot determination of p53, XPC, XPA, ERCC1 and MSH2 in tumors. GAPDH is loading control. Image collected and cropped by CiteAb from the following publication (//ovarianresearch.biomedcentral.com/articles/10.1186/1757-2215-4-9) licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: XPC Antibody (3.26) [NB100-477] - Left: HeLa cells stained with XPC (3.26) monoclonal antibody (NB100-477). Right: DAPI Staining Photo is kindly provided by Dr. S. Liu at U of Arizona.
Western Blot: XPC Antibody (3.26) [NB100-477] - HeLa whole cell lysate detected using rabbit polyclonal.
(1 Review)
(17 Publications)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
XPA Antibody
NB100-93321
Western Blot: XPA Antibody [NB100-93321] - Detection of human XPA by western blot. Samples: Whole cell lysate (50 ug) from HeLa, K-562, HEK293T, and Jurkat cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-XPA antibody NB100-93321 used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 10 seconds.
Immunohistochemistry: XPA Antibody [NB100-93321] - Detection of human XPA by immunohistochemistry. Sample: FFPE section of human breast carcinoma. Antibody: Affinity purified rabbit anti- XPA (NB100-93321). Detection: DAB.
Western Blot: XPA Antibody [NB100-93321] - Whole cell lysate (5, 15 and 50 mcg for WB; 1 mg for IP, 20% of IP loaded) from HeLa cells. NB100-93321 used for WB at 0.04 mcg/ml (A) and 0.1 mcg/ml (B) and used for IP at 3 mcg/mg lysate
Species: Hu
Applications: WB, IHC, IHC-P, IP
ERCC1 Antibody
(8F1)
NB500-704
Immunohistochemistry-Paraffin: ERCC1 Antibody (8F1) [NB500-704] - Cyto-histologic comparison of anti-ERCC1 immunoreactivity using the protocol 8F1 CC1-mono (top) or 8F1 H2-60 (bottom). Left: Pleural effusion sediment of lung adenocarcinoma. Right: thoracic lymph node. Arrow: Lymphocyte. Arrowhead: Streak of endothelial cells. Asterisk: Tumor cell cluster. 400 A- original magnification. Image collected and cropped by Cite Ab from the following publication (Automated ERCC1 immunochemistry on hybrid cytology/tissue microarray of malignant effusions: evaluation of antibodies 8F1 and D-10. J Clin Bioinforma (2011) licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: ERCC1 Antibody (8F1) [NB500-704] - Analysis of ERCC1 in human non-small cell lung cancer. Image courtesy of product review submitted by Alex Soltermann.
Immunohistochemistry-Paraffin: ERCC1 Antibody (8F1) [NB500-704] - Formalin fixed paraffin embedded human tonsil stained with ERCC1 antibody.
(1 Review)
(15 Publications)
Species: Hu, Rt, ChHa
Applications: WB, ICC/IF, IHC, IHC-P
LXR beta/NR1H2
Antibody
NB100-74457
Western Blot: LXR beta/NR1H2 Antibody [NB100-74457] - 25 ug of rat liver (Lane 1), mouse liver (Lane 2) and Hela (Lane 3) cell lysates.
Immunocytochemistry/Immunofluorescence: LXR beta/NR1H2 Antibody [NB100-74457] - Analysis of LXR beta (green) showing positive staining in the nuclear envelope of C2C12 cells (right) compared with a negative control in the absence of primary antibody (left).
(3 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Recombinant Human
CSB GST (N-Term) Prot ...
H00002074-Q01
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
GTF2H1 Antibody
(1F12-1B5)
H00002965-M01
Western Blot: GTF2H1 Antibody (1F12-1B5) [H00002965-M01] - Analysis of GTF2H1 expression in transfected 293T cell line by GTF2H1 monoclonal antibody (M01), clone 1F12-1B5.Lane 1: GTF2H1 transfected lysate(62 KDa).Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: GTF2H1 Antibody (1F12-1B5) [H00002965-M01] - Analysis of monoclonal antibody to GTF2H1 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: GTF2H1 Antibody (1F12-1B5) [H00002965-M01] - Analysis of monoclonal antibody to GTF2H1 on formalin-fixed paraffin-embedded human testis tissue.Antibody concentration 5 ug/ml.
(2 Publications)
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, RNAi, S-ELISA
GTF2H5
Overexpression Lysate
NBL1-11392
Western Blot: GTF2H5 Overexpression Lysate (Adult Normal) [NBL1-11392] Left-Empty vector transfected control cell lysate (HEK293 cell lysate); Right -Over-expression Lysate for GTF2H5.
Species: Hu
GTF2H2 Antibody
NBP3-03903
Western Blot: GTF2H2 Antibody [NBP3-03903] - Analysis of extracts of various cell lines, using GTF2H2 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit.
Immunohistochemistry-Paraffin: GTF2H2 Antibody [NBP3-03903] - Paraffin-embedded mouse heart using GTF2H2 antibody at dilution of 1:100 (40x lens).
Immunohistochemistry-Paraffin: GTF2H2 Antibody [NBP3-03903] - Paraffin-embedded rat lung using GTF2H2 antibody at dilution of 1:100 (40x lens).
Species: Hu, Mu, Rt
Applications: WB, IHC
GTF2H3 Antibody
NBP3-04662
Western Blot: GTF2H3 Antibody [NBP3-04662] - Analysis of 200ug extracts of HT-29 cells using GTF2H3 antibody. Western blot was performed from the immunoprecipitate using this antibody
Immunocytochemistry/Immunofluorescence: GTF2H3 Antibody [NBP3-04662] - Analysis of A549 cells using GTF2H3 antibody. Blue: DAPI for nuclear staining.
Western Blot: GTF2H3 Antibody [NBP3-04662] - Analysis of extracts of various cell lines, using GTF2H3 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP
GTF2H4 Antibody
H00002968-B01P
Western Blot: GTF2H4 Antibody [H00002968-B01P] - Analysis of GTF2H4 expression in transfected 293T cell line by GTF2H4 polyclonal antibody. Lane 1: GTF2H4 transfected lysate(50.82 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: GTF2H4 Antibody [H00002968-B01P] - Analysis of purified antibody to GTF2H4 on HeLa cell. (antibody concentration 10 ug/ml)
Species: Hu
Applications: WB, ICC/IF
FEN-1 Antibody
(4E7)
NB100-150
Western Blot: FEN-1 Antibody (4E7) [NB100-150] - Whole cell extract (30 ug) was separated by 12% SDS-PAGE, and the membrane was blotted with FEN1 antibody diluted at 1:500.
Immunocytochemistry/Immunofluorescence: FEN-1 Antibody (4E7) [NB100-150] - Analysis of paraformaldehyde-fixed MCF7, using antibody at 1:200 dilution.
(17 Publications)
Species: Hu, Mu
Applications: WB, ICC/IF, IP
PCNA Antibody
(PC10)
NB500-106
Western Blot: PCNA Antibody (PC10) [NB500-106] - Western blot of PCNA levels across different stages of the cell cycle. U-2 OS cells were synchronised at G1/S with 2 mM thymidine an released for 10 hours for G2/M or re-arrested in G2 for extended duration with 10uM RO-3306. Antibody at 1:2000. WB image submitted by a verified customer review.
Immunocytochemistry/Immunofluorescence: PCNA Antibody (PC10) [NB500-106] - Development of the germinal zones in the tree shrew neocortex. Immunofluorescence for PCNA (yellow) and DAPI staining (blue) on 30 um-cryosections of E32-P1 tree shrew neocortex. The top margin of the image corresponds to the transition zone SVZ/intermediate zone. Scale bars, 50 um. VZ, ventricular zone; SVZ, subventricular zone; iSVZ, inner SVZ; oSVZ, outer SVZ. Image collected and cropped by CiteAb from the following publication (http://journal.frontiersin.org/article/10.3389/fnana.2018.00029/full), licensed under a CC-BY licence.
Immunohistochemistry: PCNA Antibody (PC10) [NB500-106] - Analysis of PCNA in mouse cornea. Image courtesy of product review by Bo-Yie Chen.
(5 Reviews)
(33 Publications)
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
APE Antibody
(13B8E5C2)
NB100-116
Western Blot: APE Antibody (13B8E5C2) [NB100-116] - Whole cell protein from human HeLa, A431, mouse Neuro2A and rat PC12 cells was separated on a 12% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/mL anti-APE-1 in block buffer and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Knockdown Validated: APE Antibody (13B8E5C2) [NB100-116] - Repression of p21 by APE1 in p53-null cells and effect of ectopic p53 in this repression. Representative Western analysis of p53, APE1, p21 and alpha-Tubulin levels in the same HCT116p53null cells. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0068467) licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: APE Antibody (13B8E5C2) [NB100-116] - HeLa cells stained NB100-116 (Green) detected with DyLight Fluor 488 conjugated anti-rabbit IgG secondary antibody. Nuclei are counterstained with Hoechst 33258 (Blue).
(3 Reviews)
(93 Publications)
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, ELISA, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, ChIP, KD
XRCC1 Antibody
NBP1-87154
Western Blot: XRCC1 Antibody [NBP1-87154] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented
Western Blot: XRCC1 Antibody [NBP1-87154] - Analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Immunocytochemistry/Immunofluorescence: XRCC1 Antibody [NBP1-87154] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
CSH2 Antibody
NBP2-16019
Western Blot: CSH2 Antibody [NBP2-16019] - Sample (30 ug of whole cell lysate) A: A549 B: H1299 C: HCT116 D: MCF-7 12% SDS PAGE gel, diluted at 1:1000.
Immunohistochemistry-Paraffin: CSH2 Antibody [NBP2-16019] - Immunohistochemical analysis of paraffin-embedded Colon ca, using antibody at 1:500 dilution.
Species: Hu
Applications: WB, IHC, IHC-P
XRCC3 Antibody
NB100-165
Western Blot: XRCC3 Antibody [NB100-165] - (A) Human XRCC3 (hXRCC3) expression was down regulated by siRNA in human transofrmed fibroblasts. (B) XRCC3 was inactivated in human colon cancer cells by gene targeting [Yoshihara et all., 2004, EMBO J., 23 (3), 670-680]. hXRCC3 was detected by WB using XRCC3 antibody (NB100-165). The star indicates non-specific cross-reactivity of the antibody. Image provided by confirmed customer review.
Western Blot: XRCC3 Antibody [NB100-165] - Detection of XRCC3 (38 kDa) from HeLa cell extract using NB100-165 (1:2500). Lanes 1 and 2 contain HTC116 and Hela whole cell extracts, respectively.
(1 Review)
(13 Publications)
Species: Hu, Dr, Ha
Applications: ICC/IF (-), WB, IP
p53 Antibody (PAb
240)
NB200-103
Western Blot: p53 Antibody (PAb 240) [NB200-103] - Analysis of p53 in MCF7 and HeLa lystates. Image courtesy of anonymous customer product review.
Immunocytochemistry/Immunofluorescence: p53 Antibody (PAb 240) [NB200-103] - PC12 cells were fixed in 4% paraformaldehyde for 10 minutes and permeabilized in 0.5% Triton X-100 in PBS for 5 minutes. The cells were incubated with anti-p53 Antibody (PAb 240) NB200-103 at 2 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: p53 Antibody (PAb 240) [NB200-103] - p53 was detected in immersion fixed paraffin-embedded sections of human prostate cancer using anti-human mouse monoclonal antibody (Catalog # NB200-103) at 1:200 dilution overnight at 4C. Tissue was stained using the VisuCyte anti-mouse HRP polymer detection reagent (Catalog # VC001) with DAB chromogen (brown) and counterstained with hematoxylin (blue). Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.
(3 Reviews)
(28 Publications)
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC

Publications for XPG Protein (NBP2-47578PEP) (0)

There are no publications for XPG Protein (NBP2-47578PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for XPG Protein (NBP2-47578PEP) (0)

There are no reviews for XPG Protein (NBP2-47578PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for XPG Protein (NBP2-47578PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Learn about Custom Antibody Labeling

Additional XPG Products

Array NBP2-47578PEP

Bioinformatics Tool for XPG Protein (NBP2-47578PEP)

Discover related pathways, diseases and genes to XPG Protein (NBP2-47578PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for XPG Protein (NBP2-47578PEP)

Discover more about diseases related to XPG Protein (NBP2-47578PEP).
 

Pathways for XPG Protein (NBP2-47578PEP)

View related products by pathway.

PTMs for XPG Protein (NBP2-47578PEP)

Learn more about PTMs related to XPG Protein (NBP2-47578PEP).
 

Research Areas for XPG Protein (NBP2-47578PEP)

Find related products by research area.

Blogs on XPG.

Check out the latest blog posts on XPG.
PCNA (Proliferating cell nuclear antigen, polymerase delta auxiliary protein)
PCNA is a nuclear protein essential for DNA replication as well as DNA excision and mismatch repair pathways. It coordinates the recruitment and association of needed components during both of these processes, both of which are essential for cell cycl...  Read full blog post.
PCNA Antibodies: Marking Cell Proliferation & DNA Replication
Proliferating Cell Nuclear Antigen (PCNA), also known as the polymerase delta auxiliary protein, is a nuclear protein essential for DNA replication as well as DNA excision and mismatch repair pathways. It has a large role in cell cycle regulation and...  Read full blog post.
Using PCNA as an Antibody Marker
PCNA antibodies are useful biomarkers in DNA repair studies. PCNA is one of several proteins essential for the completion of nucleotide excision repair, a multi-stage process involving 20 - 30 proteins, and an important factor in repairing damage and...  Read full blog post.
NER Antibodies in Cancer Research
We at Novus Biologicals have over 230 products in our antibody catalog devoted to nucleotide excision repair. NER is a multi-stage sequential process involving over 30 proteins, all of which have been widely studied. Being the primary method to repair...  Read full blog post.

Customers Who Bought This Also Bought

Western Blot: APE Antibody (13B8E5C2) [NB100-116] - Whole cell protein from human HeLa, A431, mouse Neuro2A and rat PC12 cells was separated on a 12% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/mL anti-APE-1 in block buffer and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
APE Antibody (13B8E5C2)
NB100-116
Western Blot: PCNA Antibody (PC10) [NB500-106] - Western blot of PCNA levels across different stages of the cell cycle. U-2 OS cells were synchronised at G1/S with 2 mM thymidine an released for 10 hours for G2/M or re-arrested in G2 for extended duration with 10uM RO-3306. Antibody at 1:2000. WB image submitted by a verified customer review.
PCNA Antibody (PC10)
NB500-106

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our XPG Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol ERCC5