Recombinant Human XPD GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human XPD Protein [H00002068-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP, Enzyme Activity

Order Details

Recombinant Human XPD GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-405 of Human ERCC2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MRELKRTLDAKGHGVLEMPSGTGKTVSLLALIMAYQRAYPLEVTKLIYCSRTVPEIEKVIEELRKLLNFYEKQEGEKLPFLGLALSSRKNLCIHPEVTPLRFGKDVDGKCHSLTASYVRAQYQHDTSLPHCRFYEEFDAHGREVPLPAGIYNLDDLKALGRRQGWCPYFLARYSILHANVVVYSYHYLLDPKIADLVSKELARKAVVVFDEAHNIDNVCIDSMSVNLTRRTLDRCQGNLETLQKTVLRIKETDEQRLRDEYRRLVEGLREASAARETDAHLANPVLPDEVLQEAVPGSIRTAEHFLGFLRRLLEYVKWRLRVQHVVQESPPAFLSGLAQRVCIQRKPLRFCAERLRSLLHTLEITDLADFSPLTLLANFATLVSTYAKGQAQHCGSSRNQKRSHP

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
ERCC2
Purity
>10% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
70.29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using H00002068-P01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>10% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human XPD GST (N-Term) Protein

  • Basic transcription factor 2 80 kDa subunit
  • BTF2 p80
  • COFS2
  • CXPD
  • DNA excision repair protein ERCC-2
  • DNA repair protein complementing XP-D cells
  • EC 3.6.1
  • EC 3.6.4.12
  • EM9
  • EM9TFIIH basal transcription factor complex 80 kDa subunit
  • ERCC2
  • excision repair cross-complementing rodent repair deficiency, complementationgroup 2
  • MAG
  • MGC102762
  • MGC126218
  • MGC126219
  • TFIIH 80 kDa subunit
  • TFIIH basal transcription factor complex helicase subunit
  • TFIIH basal transcription factor complex helicase XPD subunit
  • TTD
  • xeroderma pigmentosum complementary group D
  • Xeroderma pigmentosum group D-complementing protein
  • XPD
  • XPDC
  • XPDTFIIH p80

Background

ERCC2( AAH08346, 1 a.a. - 406 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-61060
Species: Hu, Mu
Applications: WB, ChIP, IP
NBP1-87154
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP3-03903
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBL1-11392
Species: Hu
H00002965-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, RNAi, S-ELISA
NB500-704
Species: Hu, Rt, ChHa
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74611
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP3-04662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP
H00002968-B01P
Species: Hu
Applications: WB, ICC/IF
NB100-74457
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB100-477
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-165
Species: Hu, Dr, Ha
Applications: ICC/IF (-), WB, IP
NB100-93321
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-01020
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-116
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, ELISA, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, ChIP, KD
NB200-103
Species: Hu, Mu, Rt, Ch, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-106
Species: Hu, Mu, Rt, Pm, Rb
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NB600-326
Species: All-NA
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P, IP
H00002068-P01
Species: Hu
Applications: WB, ELISA, PA, PAGE, AP, Enzyme Activity

Publications for XPD Recombinant Protein (H00002068-P01)(1)

Reviews for XPD Recombinant Protein (H00002068-P01) (0)

There are no reviews for XPD Recombinant Protein (H00002068-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for XPD Recombinant Protein (H00002068-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional XPD Products

Bioinformatics Tool for XPD Recombinant Protein (H00002068-P01)

Discover related pathways, diseases and genes to XPD Recombinant Protein (H00002068-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for XPD Recombinant Protein (H00002068-P01)

Discover more about diseases related to XPD Recombinant Protein (H00002068-P01).
 

Pathways for XPD Recombinant Protein (H00002068-P01)

View related products by pathway.

PTMs for XPD Recombinant Protein (H00002068-P01)

Learn more about PTMs related to XPD Recombinant Protein (H00002068-P01).
 

Research Areas for XPD Recombinant Protein (H00002068-P01)

Find related products by research area.

Blogs on XPD.

Using Aflatoxin B1 Antibody for Hepatocellular Carcinoma Studies
We at Novus Biologicals are constantly updating our antibody catalog in order to provide as comprehensive a database as possible for molecular biology researchers. Not all our antibodies are derived from proteins found in mammalian or human tissue. So...  Read full blog post.

Customers Who Bought This Also Bought

OGG1 Antibody
NB100-106

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human XPD GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ERCC2