XPD Recombinant Protein Antigen

Images

 
There are currently no images for XPD Recombinant Protein Antigen (NBP2-56327PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

XPD Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human XPD.

Source: E.coli

Amino Acid Sequence: QEGEKLPFLGLALSSRKNLCIHPEVTPLRFGKDVDGKCHSLTASYVRAQYQHDTSLPHCRFYEEFDAHGREVPLPAGIYNLDDLK

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ERCC2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-56327 The protein was purified by IMAC chromatography and the expected concentration is greater than 0.5 mg/ml. This protein is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related information and a protocol, click here.
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for XPD Recombinant Protein Antigen

  • Basic transcription factor 2 80 kDa subunit
  • BTF2 p80
  • COFS2
  • CXPD
  • DNA excision repair protein ERCC-2
  • DNA repair protein complementing XP-D cells
  • EC 3.6.1
  • EC 3.6.4.12
  • EM9
  • EM9TFIIH basal transcription factor complex 80 kDa subunit
  • ERCC2
  • excision repair cross-complementing rodent repair deficiency, complementationgroup 2
  • MAG
  • MGC102762
  • MGC126218
  • MGC126219
  • TFIIH 80 kDa subunit
  • TFIIH basal transcription factor complex helicase subunit
  • TFIIH basal transcription factor complex helicase XPD subunit
  • TTD
  • xeroderma pigmentosum complementary group D
  • Xeroderma pigmentosum group D-complementing protein
  • XPD
  • XPDC
  • XPDTFIIH p80

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-61060
Species: Hu, Mu, V-Vi
Applications: ChIP, IP, WB
NBP1-87154
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP3-07348
Species: Hu
Applications: Flow, ICC/IF, PA
NBL1-11392
Species: Hu
Applications: WB
H00002965-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, S-ELISA, WB
NB500-704
Species: ChHa, Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-74611
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-87539
Species: Hu
Applications: IHC, IHC-P, WB
H00002968-B01P
Species: Hu
Applications: ICC/IF, WB
NB100-74457
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NB100-477
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-165
Species: Dr, Ha, Hu
Applications: ICC/IF (-), IP, WB
AF3416
Species: Hu
Applications: WB
NBP2-01020
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB100-116
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ChIP, ELISA, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, PLA, Simple Western, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NB100-106
Species: Hu, Mu, Po, Pm, Rb, Rt
Applications: ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NB600-326
Species: ET
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
H00002074-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-94035
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB

Publications for XPD Recombinant Protein Antigen (NBP2-56327PEP) (0)

There are no publications for XPD Recombinant Protein Antigen (NBP2-56327PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for XPD Recombinant Protein Antigen (NBP2-56327PEP) (0)

There are no reviews for XPD Recombinant Protein Antigen (NBP2-56327PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for XPD Recombinant Protein Antigen (NBP2-56327PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional XPD Products

Bioinformatics Tool for XPD Recombinant Protein Antigen (NBP2-56327PEP)

Discover related pathways, diseases and genes to XPD Recombinant Protein Antigen (NBP2-56327PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for XPD Recombinant Protein Antigen (NBP2-56327PEP)

Discover more about diseases related to XPD Recombinant Protein Antigen (NBP2-56327PEP).
 

Pathways for XPD Recombinant Protein Antigen (NBP2-56327PEP)

View related products by pathway.

PTMs for XPD Recombinant Protein Antigen (NBP2-56327PEP)

Learn more about PTMs related to XPD Recombinant Protein Antigen (NBP2-56327PEP).
 

Research Areas for XPD Recombinant Protein Antigen (NBP2-56327PEP)

Find related products by research area.

Blogs on XPD.

Using Aflatoxin B1 Antibody for Hepatocellular Carcinoma Studies
We at Novus Biologicals are constantly updating our antibody catalog in order to provide as comprehensive a database as possible for molecular biology researchers. Not all our antibodies are derived from proteins found in mammalian or human tissue. So...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our XPD Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ERCC2