XPD Recombinant Protein Antigen

Images

 
There are currently no images for XPD Recombinant Protein Antigen (NBP2-56327PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

XPD Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human XPD.

Source: E. coli

Amino Acid Sequence: QEGEKLPFLGLALSSRKNLCIHPEVTPLRFGKDVDGKCHSLTASYVRAQYQHDTSLPHCRFYEEFDAHGREVPLPAGIYNLDDLK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ERCC2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56327. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for XPD Recombinant Protein Antigen

  • Basic transcription factor 2 80 kDa subunit
  • BTF2 p80
  • COFS2
  • CXPD
  • DNA excision repair protein ERCC-2
  • DNA repair protein complementing XP-D cells
  • EC 3.6.1
  • EC 3.6.4.12
  • EM9
  • EM9TFIIH basal transcription factor complex 80 kDa subunit
  • ERCC2
  • excision repair cross-complementing rodent repair deficiency, complementationgroup 2
  • MAG
  • MGC102762
  • MGC126218
  • MGC126219
  • TFIIH 80 kDa subunit
  • TFIIH basal transcription factor complex helicase subunit
  • TFIIH basal transcription factor complex helicase XPD subunit
  • TTD
  • xeroderma pigmentosum complementary group D
  • Xeroderma pigmentosum group D-complementing protein
  • XPD
  • XPDC
  • XPDTFIIH p80

Background

The nucleotide excision repair pathway is a mechanism to repair damage to DNA. The protein encoded by this gene is involved in transcription-coupled nucleotide excision repair and is an integral member of the basal transcription factor BTF2/TFIIH complex. The gene product has ATP-dependent DNA helicase activity and belongs to the RAD3/XPD subfamily of helicases. Defects in this gene can result in three different disorders, the cancer-prone syndrome xeroderma pigmentosum complementation group D, trichothiodystrophy, and Cockayne syndrome. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-61060
Species: Hu, Mu, Rb, V-Vi
Applications: ChIP, IP, WB
NBP1-87154
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP3-07348
Species: Hu
Applications: Flow, ICC/IF, PA
NBP3-46159
Species: Hu, Mu, Rt
Applications: ELISA, IHC
H00002965-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, S-ELISA, WB
NB500-704
Species: ChHa, Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-74611
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-87539
Species: Hu
Applications: IHC, IHC-P, WB
H00002968-B01P
Species: Hu
Applications: ICC/IF, WB
NB100-74457
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NB100-477
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-165
Species: Dr, Ha, Hu
Applications: ICC/IF (-), IP, WB
AF3416
Species: Hu
Applications: WB
NBP2-01020
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB100-116
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ELISA, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, PLA, Simple Western, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NB100-106
Species: Hu, Mu, Po, Pm, Rb, Rt
Applications: ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, WB
NB600-326
Species: ET
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NBP1-32405
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-94035
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB

Publications for XPD Recombinant Protein Antigen (NBP2-56327PEP) (0)

There are no publications for XPD Recombinant Protein Antigen (NBP2-56327PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for XPD Recombinant Protein Antigen (NBP2-56327PEP) (0)

There are no reviews for XPD Recombinant Protein Antigen (NBP2-56327PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for XPD Recombinant Protein Antigen (NBP2-56327PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional XPD Products

Research Areas for XPD Recombinant Protein Antigen (NBP2-56327PEP)

Find related products by research area.

Blogs on XPD.

Using Aflatoxin B1 Antibody for Hepatocellular Carcinoma Studies
We at Novus Biologicals are constantly updating our antibody catalog in order to provide as comprehensive a database as possible for molecular biology researchers. Not all our antibodies are derived from proteins found in mammalian or human tissue. So...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our XPD Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ERCC2