FHIT Antibody (NBP1-89062)

Images

 
Western Blot: FHIT Antibody [NBP1-89062] - Analysis in control (vector only transfected HEK293T lysate) and fHIT over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: FHIT Antibody [NBP1-89062] - Staining of human kidney shows strong cytoplasmic positivity in tubule cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FHIT Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:FRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FHIT
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For HIER pH6 retrieval is recommended.
Control Peptide
FHIT Protein (NBP1-89062PEP)
Publications
Read Publications using
NBP1-89062 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 23019410).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FHIT Antibody

  • AP3A hydrolase
  • AP3AaseFRA3Bbis(5'-adenosyl)-triphosphatase
  • Diadenosine 5'-5'''-P1
  • dinucleosidetriphosphatase
  • EC 3.6.1.29
  • fragile histidine triad gene
  • Fragile histidine triad protein
  • P3-triphosphate hydrolase
  • tumor suppressor protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
NBP1-33456
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-03644
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-485
Species: Hu
Applications: WB, IP
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB100-56552
Species: Hu
Applications: WB
AF4885
Species: Mu
Applications: WB, IP
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-81776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1095
Species: Hu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICC, ICFlow
NBP2-02450
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-168
Species: Hu, Mu(-)
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, Flow-IC
NBP1-92025
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for FHIT Antibody (NBP1-89062)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for FHIT Antibody (NBP1-89062) (0)

There are no reviews for FHIT Antibody (NBP1-89062). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FHIT Antibody (NBP1-89062) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FHIT Antibody Products

Related Products by Gene

Bioinformatics Tool for FHIT Antibody (NBP1-89062)

Discover related pathways, diseases and genes to FHIT Antibody (NBP1-89062). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FHIT Antibody (NBP1-89062)

Discover more about diseases related to FHIT Antibody (NBP1-89062).
 

Pathways for FHIT Antibody (NBP1-89062)

View related products by pathway.

PTMs for FHIT Antibody (NBP1-89062)

Learn more about PTMs related to FHIT Antibody (NBP1-89062).
 

Research Areas for FHIT Antibody (NBP1-89062)

Find related products by research area.

Blogs on FHIT

There are no specific blogs for FHIT, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FHIT Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FHIT

Customers Who Bought This Also Bought