FHIT Antibody

Images

 
Western Blot: FHIT Antibody [NBP1-89062] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with a ...read more
Immunohistochemistry-Paraffin: FHIT Antibody [NBP1-89062] - Staining of human kidney shows strong cytoplasmic positivity in tubular cells.

Product Details

Summary
Reactivity Hu, Mouse, RatSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit

Order Details

FHIT Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:FRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FHIT
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For HIER pH6 retrieval is recommended.
Control Peptide
FHIT Protein (NBP1-89062PEP)
Publications
Read Publications using
NBP1-89062 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 23019410).

Alternate Names for FHIT Antibody

  • AP3A hydrolase
  • AP3AaseFRA3Bbis(5'-adenosyl)-triphosphatase
  • Diadenosine 5'-5'''-P1
  • dinucleosidetriphosphatase
  • EC 3.6.1.29
  • fragile histidine triad gene
  • Fragile histidine triad protein
  • P3-triphosphate hydrolase
  • tumor suppressor protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
MAB1489
Species: Hu
Applications: WB
NBP2-47579
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03644
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-485
Species: Hu
Applications: WB, IP
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, ICC
NB100-56552
Species: Hu
Applications: WB
NBP2-19957
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB120-3077
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-81776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
MAB8967
Species: Hu
Applications: WB, Simple Western, ICC
NBP2-02450
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-168
Species: Hu, Mu(-)
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP1-92025
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for FHIT Antibody (NBP1-89062)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for FHIT Antibody (NBP1-89062) (0)

There are no reviews for FHIT Antibody (NBP1-89062). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FHIT Antibody (NBP1-89062) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FHIT Antibody Products

Related Products by Gene

Bioinformatics Tool for FHIT Antibody (NBP1-89062)

Discover related pathways, diseases and genes to FHIT Antibody (NBP1-89062). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FHIT Antibody (NBP1-89062)

Discover more about diseases related to FHIT Antibody (NBP1-89062).
 

Pathways for FHIT Antibody (NBP1-89062)

View related products by pathway.

PTMs for FHIT Antibody (NBP1-89062)

Learn more about PTMs related to FHIT Antibody (NBP1-89062).
 

Research Areas for FHIT Antibody (NBP1-89062)

Find related products by research area.

Blogs on FHIT

There are no specific blogs for FHIT, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol FHIT

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-89062 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought