FHIT Antibody


Western Blot: FHIT Antibody [NBP1-89062] - Analysis in control (vector only transfected HEK293T lysate) and fHIT over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: FHIT Antibody [NBP1-89062] - Staining of human colon.
Immunohistochemistry-Paraffin: FHIT Antibody [NBP1-89062] - Staining of human kidney shows strong cytoplasmic positivity in tubule cells.
Independent Antibodies: Immunohistochemistry-Paraffin: FHIT Antibody [NBP1-89062] - Staining of human colon, kidney, lymph node and testis using Anti-FHIT antibody NBP1-89062 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: FHIT Antibody [NBP1-89062] - Staining of human lymph node.
Immunohistochemistry-Paraffin: FHIT Antibody [NBP1-89062] - Staining of human kidney.
Immunohistochemistry-Paraffin: FHIT Antibody [NBP1-89062] - Staining of human testis.

Product Details

Reactivity Hu, MuSpecies Glossary
Applications WB, IHC, IHC-P
Validated by:

Independent Antibodies


Order Details

FHIT Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: FRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVE
Specificity of human FHIT antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
IHC reported in scientific literature (PMID: 23019410). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FHIT Protein (NBP1-89062PEP)
Read Publications using
NBP1-89062 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 23019410).

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for FHIT Antibody

  • AP3A hydrolase
  • AP3AaseFRA3Bbis(5'-adenosyl)-triphosphatase
  • Diadenosine 5'-5'''-P1
  • dinucleosidetriphosphatase
  • EC
  • fragile histidine triad gene
  • Fragile histidine triad protein
  • P3-triphosphate hydrolase
  • tumor suppressor protein


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu
Applications: WB, IB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, IHC, IP, CyTOF-ready
Species: Hu
Applications: WB, ICC/IF, IHC
Species: Hu, Mu(-)
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, Flow-IC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for FHIT Antibody (NBP1-89062)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for FHIT Antibody (NBP1-89062) (0)

There are no reviews for FHIT Antibody (NBP1-89062). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FHIT Antibody (NBP1-89062) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional FHIT Products

Bioinformatics Tool for FHIT Antibody (NBP1-89062)

Discover related pathways, diseases and genes to FHIT Antibody (NBP1-89062). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FHIT Antibody (NBP1-89062)

Discover more about diseases related to FHIT Antibody (NBP1-89062).

Pathways for FHIT Antibody (NBP1-89062)

View related products by pathway.

PTMs for FHIT Antibody (NBP1-89062)

Learn more about PTMs related to FHIT Antibody (NBP1-89062).

Research Areas for FHIT Antibody (NBP1-89062)

Find related products by research area.

Blogs on FHIT

There are no specific blogs for FHIT, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our FHIT Antibody and receive a gift card or discount.


Gene Symbol FHIT