WSB1 Antibody

Images

 
Western Blot: WSB1 Antibody [NBP1-84162] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunocytochemistry/ Immunofluorescence: WSB1 Antibody [NBP1-84162] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemistry-Paraffin: WSB1 Antibody [NBP1-84162] - Staining of human liver shows cytoplasmic and membranous positivity in hepatocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

WSB1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:APFDKKCGRENWTVAFAPDGSYFAWSQGHRTVKLVPWSQCLQNFLLHGTKNVTNSSSLRLPRQNSDGGQKNKPREHIIDCGDIVWSLAFGSSVPEKQSRCVNIEWHRFRFGQDQLLLATGLNNGRIKIWDV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
WSB1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
WSB1 Protein (NBP1-84162PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for WSB1 Antibody

  • DKFZp564B0482
  • SOCS box-containing WD protein SWiP-1
  • SWIP1DKFZp564A122
  • WD repeat and SOCS box containing 1
  • WD repeat and SOCS box-containing 1
  • WD repeat and SOCS box-containing protein 1
  • WSB-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-00178
Species: Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP1-30943
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
H00028996-M03
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-59068
Species: Hu
Applications: WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP2-30367
Species: Hu
Applications: WB, IP
596-MR
Species: Mu
NB300-155
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-89172
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56637
Species: Hu, Mu
Applications: WB
594-ML/CF
Species: Mu
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-14200
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27210
Species: Hu, Fe, Pm
Applications: WB, IHC-P

Publications for WSB1 Antibody (NBP1-84162) (0)

There are no publications for WSB1 Antibody (NBP1-84162).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WSB1 Antibody (NBP1-84162) (0)

There are no reviews for WSB1 Antibody (NBP1-84162). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for WSB1 Antibody (NBP1-84162) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional WSB1 Products

Bioinformatics Tool for WSB1 Antibody (NBP1-84162)

Discover related pathways, diseases and genes to WSB1 Antibody (NBP1-84162). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for WSB1 Antibody (NBP1-84162)

Discover more about diseases related to WSB1 Antibody (NBP1-84162).
 

Pathways for WSB1 Antibody (NBP1-84162)

View related products by pathway.

PTMs for WSB1 Antibody (NBP1-84162)

Learn more about PTMs related to WSB1 Antibody (NBP1-84162).
 

Research Areas for WSB1 Antibody (NBP1-84162)

Find related products by research area.

Blogs on WSB1

There are no specific blogs for WSB1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our WSB1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol WSB1