AKAP1 Antibody

Images

 
Western Blot: AKAP1 Antibody [NBP1-89172] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: AKAP1 Antibody [NBP1-89172] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

AKAP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EHVLELENSKGPSLASLEGEEDKGKSSSSQVVGPVQEEEYVAEKLPSRFIESAHTELAKDDAAPAPPVADAKAQDRGVEGELGNEESLDRNEEGLDRNEEGLDRNEESLDRNEEGLDRNEEIKRAAFQIISQVISEATEQV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AKAP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
AKAP1 Protein (NBP1-89172PEP)
Publications
Read Publication using
NBP1-89172 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 23172368).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for AKAP1 Antibody

  • A kinase (PRKA) anchor protein 1
  • a kinase anchor protein 1, mitochondrial
  • AKAP121
  • AKAP149AKAP 149
  • AKAP84
  • A-kinase anchor protein 1, mitochondrial
  • A-kinase anchor protein 149 kDa
  • A-kinase anchor protein, 149kD
  • D-AKAP1
  • D-AKAP-1
  • Dual specificity A-kinase-anchoring protein 1
  • dual-specificity A-kinase anchoring protein 1
  • MGC1807
  • PRKA1
  • protein kinase A anchoring protein 1
  • protein kinase A1
  • Protein kinase A-anchoring protein 1
  • protein kinase anchoring protein 1
  • S-AKAP84
  • SAKAP84AKAP
  • Spermatid A-kinase anchor protein 84

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00011214-M10
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-38713
Species: Hu
Applications: WB, IHC, IHC-P
NB100-68211
Species: Hu
Applications: WB, IP
NBP1-89101
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP1-89170
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-02520
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-74351
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-79139
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NLS1071
Species: Hu
Applications: IHC-P
H00011216-M04
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP1-89165
Species: Hu
Applications: IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-89172
Species: Hu
Applications: WB, IHC, IHC-P

Publications for AKAP1 Antibody (NBP1-89172)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for AKAP1 Antibody (NBP1-89172) (0)

There are no reviews for AKAP1 Antibody (NBP1-89172). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AKAP1 Antibody (NBP1-89172) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AKAP1 Products

Bioinformatics Tool for AKAP1 Antibody (NBP1-89172)

Discover related pathways, diseases and genes to AKAP1 Antibody (NBP1-89172). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AKAP1 Antibody (NBP1-89172)

Discover more about diseases related to AKAP1 Antibody (NBP1-89172).
 

Pathways for AKAP1 Antibody (NBP1-89172)

View related products by pathway.

PTMs for AKAP1 Antibody (NBP1-89172)

Learn more about PTMs related to AKAP1 Antibody (NBP1-89172).

Blogs on AKAP1

There are no specific blogs for AKAP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AKAP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AKAP1
Entrez
Uniprot