LMOD1 Antibody


Western Blot: LMOD1 Antibody [NBP1-89396] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunocytochemistry/ Immunofluorescence: LMOD1 Antibody [NBP1-89396] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: LMOD1 Antibody [NBP1-89396] - Staining of human smooth muscle.
Immunohistochemistry-Paraffin: LMOD1 Antibody [NBP1-89396] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: LMOD1 Antibody [NBP1-89396] - Staining of human prostate shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: LMOD1 Antibody [NBP1-89396] - Staining in human prostate and liver tissues using anti-LMOD1 antibody. Corresponding LMOD1 RNA-seq data are presented for the ...read more
Immunohistochemistry-Paraffin: LMOD1 Antibody [NBP1-89396] - Staining of human colon.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

LMOD1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: TEKQSTGVYNREAMLNFCEKETKKLMQREMSMDESKQVETKTDAKNGEERGRDASKKALGPRRDSDLGKEPK
Specificity of human LMOD1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
LMOD1 Protein (NBP1-89396PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for LMOD1 Antibody

  • 64 kDa autoantigen 1D
  • 64 kDa autoantigen 1D3,1D
  • 64 kDa autoantigen D1,64kD
  • D1
  • FLJ55689
  • leimodin 1 (smooth muscle)
  • leiomodin 1 (smooth muscle)
  • Leiomodin, muscle form
  • leiomodin-1
  • Smooth muscle leiomodin
  • thyroid and eye muscle autoantigen D1 (64kD)
  • Thyroid-associated ophthalmopathy autoantigen


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA
Species: Hu, Mu, Rt, Ha, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD
Species: Hu, Mu, Rt, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, ICC
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), ELISA(Sta)
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P, IP, Flow-IC
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Pm, Pm, Bv(-), Ca(-), Po(-), Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IF
Species: Hu
Applications: WB, ICC/IF, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, KO
Species: Hu, Mu, Rt, Bv, Fe
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for LMOD1 Antibody (NBP1-89396) (0)

There are no publications for LMOD1 Antibody (NBP1-89396).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LMOD1 Antibody (NBP1-89396) (0)

There are no reviews for LMOD1 Antibody (NBP1-89396). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for LMOD1 Antibody (NBP1-89396) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional LMOD1 Products

Bioinformatics Tool for LMOD1 Antibody (NBP1-89396)

Discover related pathways, diseases and genes to LMOD1 Antibody (NBP1-89396). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LMOD1 Antibody (NBP1-89396)

Discover more about diseases related to LMOD1 Antibody (NBP1-89396).

Pathways for LMOD1 Antibody (NBP1-89396)

View related products by pathway.

Research Areas for LMOD1 Antibody (NBP1-89396)

Find related products by research area.

Blogs on LMOD1

There are no specific blogs for LMOD1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our LMOD1 Antibody and receive a gift card or discount.


Gene Symbol LMOD1