Wnt-5a Antibody - BSA Free

Western Blot: Wnt-5a Antibody [NBP1-60032] - Hela Cell Lysate 1.0 ug/ml, gel concentration 12%

Immunohistochemistry: Wnt-5a Antibody [NBP1-60032] - Human Adult heart Observed Staining: Cytoplasmic,Membrane Primary Antibody Concentration: 1 : 600 Secondary Antibody: Donkey anti-Rabbit-Cy2/3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X Exposure Time: 0.5 2.0 sec.

Immunohistochemistry-Paraffin: Wnt-5a Antibody [NBP1-60032] - Human Brain, Cortex: Formalin-Fixed, Paraffin-Embedded (FFPE)

Immunohistochemistry-Paraffin: Wnt-5a Antibody [NBP1-60032] - Human Colon, Myenteric Plexus: Formalin-Fixed, Paraffin-Embedded (FFPE)

Immunohistochemistry-Paraffin: Wnt-5a Antibody [NBP1-60032] - Human Placenta: Formalin-Fixed, Paraffin-Embedded (FFPE)

• Reactivity: Hu, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Wnt-5a Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to WNT5A(wingless-type MMTV integration site family, member 5A) The peptide sequence was selected from the middle region of WNT5A. Peptide sequence GGCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRT. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: WNT5A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 29563288).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Wnt-5a Antibody - BSA Free

• hWNT5A
• protein Wnt-5a
• wingless-type MMTV integration site family, member 5A
• WNT-5A protein
• Wnt5a
• Wnt-5a

Background

The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. WNT5A is a member of the WNT protein family. It shows 98%, 98% and 87% amino acid identity to the mouse, rat and the xenopus Wnt5A protein, respectively. The experiments performed in Xenopus laevis embryos identified that human frizzled-5 (hFz5) is the receptor for the Wnt5A ligand and the Wnt5A/hFz5 signaling mediates axis induction.The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family. It encodes a protein which shows 98%, 98% and 87% amino acid identity to the mouse, rat and the xenopus Wnt5A protein, respectively. The experiments performed in Xenopus laevis embryos identified that human frizzled-5 (hFz5) is the receptor for the Wnt5A ligand and the Wnt5A/hFz5 signaling mediates axis induction. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Wnt-5a Antibody (NBP1-60032)(1)

Publication using NBP1-60032

• Zerboni L, Sung P, Lee G, Arvin A. Age-associated differences in infection of human skin in the SCID mouse model of varicella-zoster virus pathogenesis. J. Virol. 2018-03-21 [PMID: 29563288] (Mouse)

Bioinformatics

• Gene Symbol: WNT5A
• Uniprot:
  • P41221()