Wnt-3a Antibody - BSA Free

Western Blot: Wnt-3a Antibody [NBP1-79724] - Titration: 0.2-1 ug/ml, Positive Control: Human heart.

Immunohistochemistry-Paraffin: Wnt-3a Antibody [NBP1-79724] - Human prostate tissue at an antibody concentration of 2.5 ug/ml.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Wnt-3a Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptide directed towards the N terminal of human WNT3AThe immunogen for this antibody is WNT3A (NP_149122). Peptide sequence MAPLGYFLLLCSLKQALGSYPIWWSLAVGPQYSSLGSQPILCASIPGLVP. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: WNT3A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 5 ug/ml
  • Western Blot 1.0 ug/ml
• Theoretical MW: 39 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Wnt-3a Antibody - BSA Free

• MGC119418
• MGC119419
• MGC119420
• protein Wnt-3a
• wingless-type MMTV integration site family, member 3A
• Wnt3a
• Wnt-3a

Background

Wingless-type MMTV integration site family, member 3A (Wnt3a) is a member of the Wnt family. The Wnt gene family is representative of a growing class of multifunctioanl factors that play a role in both tumorigenesis and patterning events required for normal differentiation and development. Wnt3a is a ligand for members of the frizzled family of seven transmembrane receptors. Anti-human Wnt3a mAb, clone 3A6, is derived from hybridization of mouse F0 myeloma cells with spleen cells from BALB/c mice immunized with a recombinant human Wnt3a protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: WNT3A
• Entrez:
  • 89780(Human)
• Uniprot:
  • P56704(Human)