WNK1 Antibody

Images

 
Immunohistochemistry-Paraffin: WNK1 Antibody [NBP2-32434] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

WNK1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PPFPAPSLTQSQQPLEDLDAQLRRTLSPEMITVTSAVGPVSMAAPTAITEAGTQPQKGVSQVKEGPVLATSSGAGVFKMGRFQVSVAADGA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
WNK1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
WNK1 Protein (NBP2-32434PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for WNK1 Antibody

  • EC 2.7.11
  • EC 2.7.11.1
  • Erythrocyte 65 kDa protein
  • HSAN2hereditary sensory neuropathy, type II
  • HSN2MGC163339
  • hWNK1
  • KDP
  • KDPMGC163341
  • KIAA0344
  • Kinase deficient protein
  • p65
  • PHA2C
  • PRKWNK1
  • PRKWNK1PSK
  • prostate-derived sterile 20-like kinase
  • Protein kinase lysine-deficient 1
  • Protein kinase with no lysine 1
  • protein kinase, lysine deficient 1
  • serine/threonine-protein kinase WNK1
  • WNK lysine deficient protein kinase 1
  • WNK1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
DDX0131P-100
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-88650
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-01345
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB100-56507
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2699
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP2-47415
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3235
Species: Hu, Mu, Rt
Applications: WB, IHC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)

Publications for WNK1 Antibody (NBP2-32434) (0)

There are no publications for WNK1 Antibody (NBP2-32434).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WNK1 Antibody (NBP2-32434) (0)

There are no reviews for WNK1 Antibody (NBP2-32434). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for WNK1 Antibody (NBP2-32434) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional WNK1 Products

Bioinformatics Tool for WNK1 Antibody (NBP2-32434)

Discover related pathways, diseases and genes to WNK1 Antibody (NBP2-32434). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for WNK1 Antibody (NBP2-32434)

Discover more about diseases related to WNK1 Antibody (NBP2-32434).
 

Pathways for WNK1 Antibody (NBP2-32434)

View related products by pathway.

PTMs for WNK1 Antibody (NBP2-32434)

Learn more about PTMs related to WNK1 Antibody (NBP2-32434).
 

Research Areas for WNK1 Antibody (NBP2-32434)

Find related products by research area.

Blogs on WNK1

There are no specific blogs for WNK1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our WNK1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol WNK1
Entrez