WIBG Antibody - Azide and BSA Free

Western Blot: WIBG Antibody [NBP3-15586] - Analysis of extracts of various cell lines, using WIBG Rabbit pAb (NBP3-15586) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 90s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

WIBG Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit WIBG Antibody - Azide and BSA Free (NBP3-15586) is a polyclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-204 of human WIBG (NP_115721.1). MEAAGSPAATETGKYIASTQRPDGTWRKQRRVKEGYVPQEEVPVYENKYVKFFKSKPELPPGLSPEATAPVTPSRPEGGEPGLSKTAKRNLKRKEKRRQQQEKGEAEALSRTLDKVSLEETAQLPSAPQGSRAAPTAASDQPDSAATTEKAKKIKNLKKKLRQVEELQQRIQAGEVSQPSKEQLEKLARRRALEEELEDLELGL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PYM1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 23 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for WIBG Antibody - Azide and BSA Free

• MGC13064
• partner of Y14 and mago
• PYMProtein wibg homolog
• within bgcn homolog (Drosophila)

Background

Key regulator of the exon junction complex (EJC), a multiprotein complex that associates immediately upstreamof the exon-exon junction on mRNAs and serves as a positional landmarks for the intron exon structure of genes anddirects post-transcriptional processes in the cytoplasm such as mRNA export, nonsense-mediated mRNA decay (NMD) ortranslation. Acts as a EJC disassembly factor, allowing translation-dependent EJC removal and recycling by disruptingmature EJC from spliced mRNAs. Its association with the 40S ribosomal subunit probably prevents atranslation-independent disassembly of the EJC from spliced mRNAs, by restricting its activity to mRNAs that have beentranslated. Interferes with NMD and enhances translation of spliced mRNAs, probably by antagonizing EJC functions. Maybind RNA; the relevance of RNA-binding remains unclear in vivo, RNA-binding was detected by PubMed:14968132, whilePubMed:19410547 did not detect RNA-binding activity independently of the EJC

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: PYM1