WIBG Antibody - Azide and BSA Free Summary
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-204 of human WIBG (NP_115721.1). MEAAGSPAATETGKYIASTQRPDGTWRKQRRVKEGYVPQEEVPVYENKYVKFFKSKPELPPGLSPEATAPVTPSRPEGGEPGLSKTAKRNLKRKEKRRQQQEKGEAEALSRTLDKVSLEETAQLPSAPQGSRAAPTAASDQPDSAATTEKAKKIKNLKKKLRQVEELQQRIQAGEVSQPSKEQLEKLARRRALEEELEDLELGL |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
PYM1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
- Western Blot 1:500 - 1:2000
|
| Theoretical MW |
23 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.01% Thimerosal |
| Purity |
Affinity purified |
Alternate Names for WIBG Antibody - Azide and BSA Free
Background
Key regulator of the exon junction complex (EJC), a multiprotein complex that associates immediately upstreamof the exon-exon junction on mRNAs and serves as a positional landmarks for the intron exon structure of genes anddirects post-transcriptional processes in the cytoplasm such as mRNA export, nonsense-mediated mRNA decay (NMD) ortranslation. Acts as a EJC disassembly factor, allowing translation-dependent EJC removal and recycling by disruptingmature EJC from spliced mRNAs. Its association with the 40S ribosomal subunit probably prevents atranslation-independent disassembly of the EJC from spliced mRNAs, by restricting its activity to mRNAs that have beentranslated. Interferes with NMD and enhances translation of spliced mRNAs, probably by antagonizing EJC functions. Maybind RNA; the relevance of RNA-binding remains unclear in vivo, RNA-binding was detected by PubMed:14968132, whilePubMed:19410547 did not detect RNA-binding activity independently of the EJC
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu, Mu, Rt, Ye
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: V-Vi
Applications: ELISA, IHC, WB
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: IHC, IHC-P, IP, WB (-)
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov
Publications for WIBG Antibody (NBP3-15586) (0)
There are no publications for WIBG Antibody (NBP3-15586).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for WIBG Antibody (NBP3-15586) (0)
There are no reviews for WIBG Antibody (NBP3-15586).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for WIBG Antibody (NBP3-15586) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional WIBG Products
Research Areas for WIBG Antibody (NBP3-15586)
Find related products by research area.
|
Blogs on WIBG