WHIP Antibody


Western Blot: WHIP Antibody [NBP1-90030] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-638
Immunohistochemistry-Paraffin: WHIP Antibody [NBP1-90030] - Staining of human testis shows strong nuclear positivity in cells of seminiferus ducts.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

WHIP Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: YQGCHFIGMPECEVLLAQCVVYFARAPKSIEVYSAYNNVKARLRNHQGPLPPVPLHLRNAPTRLMKDLGYG
Specificity of human WHIP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Positive Control
WHIP Lysate (NBP2-65211)
Control Peptide
WHIP Protein (NBP1-90030PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for WHIP Antibody

  • ATPase WRNIP1
  • bA420G6.2
  • EC 3.6.1
  • FLJ22526
  • putative helicase RUVBL
  • Werner helicase interacting protein 1
  • Werner helicase-interacting protein 1
  • WHIPRP11-420G6.2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ChIP, ICC/IF, IP
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
Species: Mu
Applications: ICC
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF
Species: Hu, Mu, Rt, Po, ChHa, Pm
Applications: WB, EM, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu, Mu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-CS, Flow-IC
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for WHIP Antibody (NBP1-90030) (0)

There are no publications for WHIP Antibody (NBP1-90030).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WHIP Antibody (NBP1-90030) (0)

There are no reviews for WHIP Antibody (NBP1-90030). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for WHIP Antibody (NBP1-90030) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional WHIP Products

Bioinformatics Tool for WHIP Antibody (NBP1-90030)

Discover related pathways, diseases and genes to WHIP Antibody (NBP1-90030). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for WHIP Antibody (NBP1-90030)

Discover more about diseases related to WHIP Antibody (NBP1-90030).

Pathways for WHIP Antibody (NBP1-90030)

View related products by pathway.

PTMs for WHIP Antibody (NBP1-90030)

Learn more about PTMs related to WHIP Antibody (NBP1-90030).

Blogs on WHIP

There are no specific blogs for WHIP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our WHIP Antibody and receive a gift card or discount.


Gene Symbol WRNIP1