WHIP Antibody

Images

 
Western Blot: WHIP Antibody [NBP1-90030] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-638
Immunohistochemistry-Paraffin: WHIP Antibody [NBP1-90030] - Staining of human testis shows strong nuclear positivity in cells of seminiferus ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

WHIP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:YQGCHFIGMPECEVLLAQCVVYFARAPKSIEVYSAYNNVKARLRNHQGPLPPVPLHLRNAPTRLMKDLGYG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
WRNIP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
WHIP Protein (NBP1-90030PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for WHIP Antibody

  • ATPase WRNIP1
  • bA420G6.2
  • EC 3.6.1
  • FLJ22526
  • putative helicase RUVBL
  • Werner helicase interacting protein 1
  • Werner helicase-interacting protein 1
  • WHIPRP11-420G6.2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-471
Species: Hu
Applications: WB, ChIP, ICC/IF, IP
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP1-93859
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00056852-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB8099
Species: Mu
Applications: ICC
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
H00011116-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-84975
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-06672
Species: Hu
NB110-58748
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF
NB400-148
Species: Hu, Mu, Rt, Po, ChHa, Pm
Applications: WB, EM, ICC/IF, IHC, IHC-P
AF5414
Species: Hu
Applications: WB, Simple Western
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-24787
Species: Hu, Mu, Ca
Applications: WB, Flow, IHC, IHC-Fr, IHC-P, Flow-CS, Flow-IC
NBP2-37477
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NB100-56360
Species: Hu
Applications: WB
NBP1-90030
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for WHIP Antibody (NBP1-90030) (0)

There are no publications for WHIP Antibody (NBP1-90030).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WHIP Antibody (NBP1-90030) (0)

There are no reviews for WHIP Antibody (NBP1-90030). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for WHIP Antibody (NBP1-90030) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional WHIP Products

Bioinformatics Tool for WHIP Antibody (NBP1-90030)

Discover related pathways, diseases and genes to WHIP Antibody (NBP1-90030). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for WHIP Antibody (NBP1-90030)

Discover more about diseases related to WHIP Antibody (NBP1-90030).
 

Pathways for WHIP Antibody (NBP1-90030)

View related products by pathway.

PTMs for WHIP Antibody (NBP1-90030)

Learn more about PTMs related to WHIP Antibody (NBP1-90030).

Blogs on WHIP

There are no specific blogs for WHIP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our WHIP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol WRNIP1