Wee1 Antibody (6V1Y6)

Immunohistochemistry: Wee1 Antibody (6V1Y6) [NBP3-33344] - Immunohistochemistry analysis of paraffin-embedded Mouse lung using Wee1 Rabbit mAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

• Reactivity: Mu
• Applications: ELISA, IHC
• Clone: 6V1Y6
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Wee1 Antibody (6V1Y6) Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Wee1 (NP_003381.1).
  
  Sequence:
  MSFLSRQQPPPPRRAGAACTLRQKLIFSPCSDCEEEEEEEEEEGSGHSTGEDSAFQEPDSPLPPARSPTEPGPERRRSPGPAPGSPGELEEDLLLPGACP
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: WEE1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Theoretical MW: 72 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for Wee1 Antibody (6V1Y6)

• DKFZp686I18166
• EC 2.7.10.2
• FLJ16446
• WEE1 homolog (S. pombe)
• Wee1
• wee1+ (S. pombe) homolog
• WEE1+ homolog
• Wee1A kinase
• WEE1A
• WEE1hu
• wee1-like protein kinase

Background

Wee1 encodes a nuclear protein, which is a tyrosine kinase belonging to the Ser/Thr family of protein kinases. This protein catalyzes the inhibitory tyrosine phosphorylation of CDC2/cyclin B kinase, and appears to coordinate the transition between DNA replication and mitosis by protecting the nucleus from cytoplasmically activated CDC2 kinase.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: WEE1