WDR5 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: WDR5 Antibody [NBP2-55518] - Staining of human cell line U-2 OS shows localization to nucleoplasm.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

WDR5 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ATEEKKPETEAARAQPTPSSSATQSKPTPVKPNYALKFTLAGHTKAVSS
Specificity
Specificity of human WDR5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
WDR5
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for WDR5 Antibody

  • BIG3
  • BIG-3
  • BMP2-induced 3-kb gene protein
  • SWD3
  • SWD3, Set1c WD40 repeat protein, homolog
  • WD repeat domain 5
  • WD repeat-containing protein 5
  • WDR5
  • WD-repeat protein 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-30141
Species: Hu, Mu, Rt, Po, Ce, Dr, In, Ma, Ye
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
NB600-250
Species: Hu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, ChIP
NB600-252
Species: Hu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, CHIP-SEQ
NB100-558
Species: Hu
Applications: WB, ChIP, IHC, IHC-P, IP, CHIP-SEQ
NB100-68210
Species: Hu, Mu
Applications: WB, IP
NB300-864
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-89123
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-55251
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), ICC, Neut, ELISA(Sta)
AF6539
Species: Hu
Applications: WB, IHC
NBP2-07996
Species: Hu
NBP2-52486
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, ICC, IF
NBP1-77461
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67727
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2379
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, Flow, ICC/IF, IHC
AF7637
Species: Hu
Applications: WB
H00005308-M01
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for WDR5 Antibody (NBP2-55518) (0)

There are no publications for WDR5 Antibody (NBP2-55518).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WDR5 Antibody (NBP2-55518) (0)

There are no reviews for WDR5 Antibody (NBP2-55518). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for WDR5 Antibody (NBP2-55518) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional WDR5 Products

Bioinformatics Tool for WDR5 Antibody (NBP2-55518)

Discover related pathways, diseases and genes to WDR5 Antibody (NBP2-55518). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for WDR5 Antibody (NBP2-55518)

Discover more about diseases related to WDR5 Antibody (NBP2-55518).
 

Pathways for WDR5 Antibody (NBP2-55518)

View related products by pathway.

PTMs for WDR5 Antibody (NBP2-55518)

Learn more about PTMs related to WDR5 Antibody (NBP2-55518).

Blogs on WDR5

There are no specific blogs for WDR5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our WDR5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol WDR5