VWCE Antibody

Images

 
Western Blot: VWCE Antibody [NBP2-30467] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251 MGLane 4: Human plasmaLane 5: Human Liver tissueLane 6: Human ...read more
Immunocytochemistry/ Immunofluorescence: VWCE Antibody [NBP2-30467] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & vesicles.
Immunohistochemistry-Paraffin: VWCE Antibody [NBP2-30467] - Staining of human prostate shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

VWCE Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: GGDECTTCVCQNGEVECSFMPCPELACPREEWRLGPGQCCFTCQEPTPSTGCSLDDNGVEFPIGQIWSPGDPCELCICQADGSVSCKRTDCVDSCP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
VWCE
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
VWCE Protein (NBP2-30467PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for VWCE Antibody

  • URG11
  • VWC1
  • VWCE von Willebrand factor C and EGF domains

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

355-BM/CF
Species: Hu, Mu, Rt
AF2299
Species: Mu
Applications: WB, IHC
NBP2-13980
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-586
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
MAB2520
Species: Mu
Applications: WB, IHC, IP
NBP1-89917
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF756
Species: Mu
Applications: WB, IHC
NBP2-37578
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF743
Species: Mu
Applications: WB, Flow, CyTOF-ready
MAB4104
Species: Hu
Applications: WB, IP, Neut
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB500-180
Species: Hu, Mu, Rt, Po, Ma
Applications: WB, Simple Western, ICC/IF, IP
AF847
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
MAB4605
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for VWCE Antibody (NBP2-30467) (0)

There are no publications for VWCE Antibody (NBP2-30467).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VWCE Antibody (NBP2-30467) (0)

There are no reviews for VWCE Antibody (NBP2-30467). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for VWCE Antibody (NBP2-30467) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional VWCE Products

Bioinformatics Tool for VWCE Antibody (NBP2-30467)

Discover related pathways, diseases and genes to VWCE Antibody (NBP2-30467). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

PTMs for VWCE Antibody (NBP2-30467)

Learn more about PTMs related to VWCE Antibody (NBP2-30467).

Blogs on VWCE

There are no specific blogs for VWCE, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our VWCE Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol VWCE
Uniprot