VPS4A Antibody

Western Blot: VPS4A Antibody [NBP1-54618] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

Western Blot: VPS4A Antibody [NBP1-54618] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:312500 Positive Control: Human Muscle

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

VPS4A Antibody Summary

• Immunogen: Synthetic peptides corresponding to VPS4A(vacuolar protein sorting 4 homolog A (S. cerevisiae)) The peptide sequence was selected from the N terminal of VPS4A. Peptide sequence YFLHAIKYEAHSDKAKESIRAKCVQYLDRAEKLKDYLRSKEKHGKKPVKE.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: VPS4A
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:100-1:2000
  • Immunohistochemistry
• Application Notes: This is a rabbit polyclonal antibody against VPS4A and was validated on Western blot.
• Theoretical MW: 49 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for VPS4A Antibody

• FLJ22197
• hVPS4
• Protein SKD2
• SKD1
• SKD1A
• SKD2
• vacuolar protein sorting 4 homolog A (S. cerevisiae)
• vacuolar protein sorting 4A (yeast homolog)
• vacuolar protein sorting factor 4A
• vacuolar protein sorting-associated protein 4A
• vacuolar sorting protein 4
• VPS4-1SKD1-homolog
• VPS4vacuolar protein sorting 4A (yeast)

Background

VPS4A is a member of the AAA protein family (ATPases associated with diverse cellular activities), and is the homolog of the yeast Vps4 protein. In humans, two paralogs of the yeast protein have been identified. Functional studies indicate that both human paralogs associate with the endosomal compartments, and are involved in intracellular protein trafficking, similar to Vps4 protein in yeast.The protein encoded by this gene is a member of the AAA protein family (ATPases associated with diverse cellular activities), and is the homolog of the yeast Vps4 protein. In humans, two paralogs of the yeast protein have been identified. The former share a high degree of aa sequence similarity with each other, and also with yeast Vps4 and mouse Skd1 proteins. The mouse Skd1 (suppressor of K+ transport defect 1) has been shown to be really an yeast Vps4 ortholog. Functional studies indicate that both human paralogs associate with the endosomal compartments, and are involved in intracellular protein trafficking, similar to Vps4 protein in yeast. The gene encoding this paralog has been mapped to chromosome 16; the gene for the other resides on chromosome 18. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: VPS4A
• Uniprot:
  • Q9UN37(Human)