CHMP4B Antibody - BSA Free

Western Blot: CHMP4B Antibody [NBP1-91782] - Analysis in control (vector only transfected HEK293T lysate) and CHMP4B over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: CHMP4B Antibody [NBP1-91782] - Staining of human kidney shows moderate to strong granular cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: CHMP4B Antibody [NBP1-91782] - Staining of human liver shows weak granular cytoplasmic positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: CHMP4B Antibody [NBP1-91782] - Staining of human small intestine shows moderate to strong granular cytoplasmic positivity in glandular cells.

Analysis in control (vector only transfected HEK293T lysate) and CHMP4B over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CHMP4B Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CHMP4B Antibody - BSA Free (NBP1-91782) is a polyclonal antibody validated for use in IHC and WB. Anti-CHMP4B Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SVFGKLFGAGGGKAGKGGPTPQEAIQRLRDTEEMLSKK
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CHMP4B
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  CHMP4B Protein (NBP1-91782PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CHMP4B Antibody - BSA Free

• C20orf178
• charged multivesicular body protein 4b
• CHMP4A
• CHMP4b
• chromatin modifying protein 4B
• Chromatin-modifying protein 4b
• chromosome 20 open reading frame 178
• dJ553F4.4
• hSnf7-2
• hVps32-2
• Shax1
• SNF7 homolog associated with Alix 1
• Snf7 homologue associated with Alix 1
• SNF7
• SNF7-2CTPP3
• Vacuolar protein sorting-associated protein 32-2
• vacuolar protein-sorting-associated protein 32-2
• Vps32-2
• VPS32B

Background

Component of the escrt-iii complex, which is required for multivesicular bodies (mvbs) formation and sorting of endosomal cargo proteins into mvbs. the mvb pathway mediates delivery of transmembrane proteins into the lumen of the lysosome for degradation. the escrt-iii complex is probably involved in the concentration of mvb cargo. in the escrt-iii complex, it probably serves as an acceptor for escrt-i complex on endosomal membranes. in case of infection, the hiv-1 virus takes advantage of the escrt-iii complex for budding and exocytic cargos of viral proteins, via the association of chmp4 proteins with pdcd6ip/aip1, a protein directly recruited by hiv-1 p6 protein that functions at sites of viral gag assembly and budding.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CHMP4B Antibody (NBP1-91782)(1)

Publication using NBP1-91782

• Westman J, Plumb J, Licht A et al. Calcium-dependent ESCRT recruitment and lysosome exocytosis maintain epithelial integrity during Candida albicans invasion Cell reports 2022-01-04 [PMID: 34986345] (WB)

Bioinformatics

• Gene Symbol: CHMP4B