Alix Antibody

Images

 
Genetic Strategies: Western Blot: Alix Antibody [NBP1-90201] - Analysis in U-138MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-PDCD6IP antibody. Remaining relative ...read more
Immunocytochemistry/ Immunofluorescence: Alix Antibody [NBP1-90201] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Alix Antibody [NBP1-90201] - Staining of human fallopian tube shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Alix Antibody [NBP1-90201] - Staining of human gastrointestinal shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Alix Antibody [NBP1-90201] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: Alix Antibody [NBP1-90201] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

   

Order Details

Alix Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VPVSVQQSLAAYNQRKADLVNRSIAQMREATTLANGVLASLNLPAAIEDVSGDTVPQSILTKSRSVIEQGGIQTVDQLIKELPELLQRNREILDESLRLLDEEEATDND
Marker
Exosome Marker
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PDCD6IP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Alix Protein (NBP1-90201PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-90201 in the following applications:

Publications
Read Publications using
NBP1-90201 in the following applications:

  • WB
    7 publications

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Alix Antibody

  • AIP1DRIP4
  • ALG-2 interacting protein 1
  • ALG-2 interacting protein X
  • ALG-2-interacting protein 1
  • alinx
  • Alix
  • apoptosis-linked gene 2-interacting protein X
  • dopamine receptor interacting protein 4
  • HP95
  • KIAA1375
  • MGC17003
  • PDCD6-interacting protein
  • programmed cell death 6 interacting protein
  • programmed cell death 6-interacting protein

Background

Alix encodes a protein thought to participate in programmed cell death. Studies using mouse cells have shown that overexpression of this protein can block apoptosis. In addition, the product of this gene binds to the product of the PDCD6 gene, a protein required for apoptosis, in a calcium-dependent manner. This gene product also binds to endophilins, proteins that regulate membrane shape during endocytosis. Overexpression of this gene product and endophilins results in cytoplasmic vacuolization which may be partly responsible for the protection against cell death.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Alix Antibody (NBP1-90201)(10)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(7)
All Applications
Filter By Species
Human
(6)
All Species
Showing Publications 1 - 10 of 10.
Publications using NBP1-90201 Applications Species
Blommer J, Pitcher T, Mustapic M et al. Extracellular vesicle biomarkers for cognitive impairment in Parkinson's disease Brain : a journal of neurology 2022-07-14 [PMID: 35833836]
Busch DJ, Zhang y, Kumar A et al. Identification of RNA content of CHO-derived extracellular vesicles from a production process Journal of biotechnology 2022-03-12 [PMID: 35292346] (WB) WB
Aiello A, Giannessi F, Percario ZA et al. HIV-1 Nef Protein Affects Cytokine and Extracellular Vesicles Production in the GEN2.2 Plasmacytoid Dendritic Cell Line Viruses 2021-12-31 [PMID: 35062278] (WB, Human) WB Human
Yao PJ, Eren E, Goetzl EJ, Kapogiannis D Mitochondrial Electron Transport Chain Protein Abnormalities Detected in Plasma Extracellular Vesicles in Alzheimer's Disease Biomedicines 2021-10-31 [PMID: 34829816] (WB, Human) WB Human
Carlomagno C, Giannasi C, Niada S et al. Raman Fingerprint of Extracellular Vesicles and Conditioned Media for the Reproducibility Assessment of Cell-Free Therapeutics Frontiers in Bioengineering and Biotechnology 2021-04-13 [PMID: 33928071] (WB, Human) WB Human
Millan C, Prause L, Vallmajo-Martin Q et al. Extracellular Vesicles from 3D Engineered Microtissues Harbor Disease-Related Cargo Absent in EVs from 2D Cultures Advanced healthcare materials 2021-04-22 [PMID: 33890421]
Morris C, Durand S, Jalinot P Decreased expression of the translation factor eIF3e induces senescence in breast cancer cells via suppression of PARP1 and activation of mTORC1 Oncotarget 2021-03-30 [PMID: 33868586] (WB, Human) WB Human
Mansur RB, Delgado-Peraza F, Subramaniapillai M et al. Exploring brain insulin resistance in adults with bipolar depression using extracellular vesicles of neuronal origin Journal of psychiatric research 2020-12-04 [PMID: 33316649] (WB, Human) WB Human
Nogueras-Ortiz, C J, Mahairaki, V Et al. Astrocyte- and Neuron-Derived Extracellular Vesicles from Alzheimer's Disease Patients Effect Complement-Mediated Neurotoxicity. Cells 2020-07-04 [PMID: 32635578] (WB, Human) WB Human
Beckwith KS, Beckwith MS, Ullmann S et al. Plasma membrane damage causes NLRP3 activation and pyroptosis during Mycobacterium tuberculosis infection Nat Commun 2020-05-10 [PMID: 32385301]

Review for Alix Antibody (NBP1-90201) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Rat.

Reviews using NBP1-90201:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Rat
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot Alix NBP1-90201
Enlarge
5
reviewed by:
Verified Customer
WB Rat 01/17/2018
View

Summary

ApplicationWestern Blot
Sample TestedRat astrocytes
SpeciesRat
LotA114984

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Alix Antibody (NBP1-90201) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Alix Products

Research Areas for Alix Antibody (NBP1-90201)

Find related products by research area.

Blogs on Alix.

Tools for Isolation, Quantification and Analysis of Exosomes
Exosomes are spherical to cup-shaped bilayered membrane enclosed nanosize vesicles (30-100 nm) which have the ability to shuttle active cargoes between cells. Johnstone et al. 1987 pioneered in documenting the generation of exosomes in differentiat...  Read full blog post.

mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Verified Customer
01/17/2018
Application: WB
Species: Rat

Bioinformatics

Gene Symbol PDCD6IP