Alix Antibody

Images

 
Genetic Strategies: Western Blot: Alix Antibody [NBP1-90201] - Analysis in U-138MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-PDCD6IP antibody. Remaining relative ...read more
Immunocytochemistry/ Immunofluorescence: Alix Antibody [NBP1-90201] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Alix Antibody [NBP1-90201] - Staining of human stomach shows moderate cytoplasmic positivity in glandular cells.
Western Blot: Alix Antibody [NBP1-90201] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

   

Order Details

Alix Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VPVSVQQSLAAYNQRKADLVNRSIAQMREATTLANGVLASLNLPAAIEDVSGDTVPQSILTKSRSVIEQGGIQTVDQLIKELPELLQRNREILDESLRLLDEEEATDND
Marker
Exosome Marker
Specificity
Specificity of human, mouse, rat Alix antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PDCD6IP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Alix Protein (NBP1-90201PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-90201 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Alix Antibody

  • AIP1DRIP4
  • ALG-2 interacting protein 1
  • ALG-2 interacting protein X
  • ALG-2-interacting protein 1
  • alinx
  • Alix
  • apoptosis-linked gene 2-interacting protein X
  • dopamine receptor interacting protein 4
  • HP95
  • KIAA1375
  • MGC17003
  • PDCD6-interacting protein
  • programmed cell death 6 interacting protein
  • programmed cell death 6-interacting protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00010016-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB200-112
Species: Hu, Mu, Rt, Ha, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KO
NBP2-65248
Species: Hu
NBP1-91782
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-54618
Species: Hu
Applications: WB, IHC
NBP1-85614
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF7117
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP2-00527
Species: Hu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-71702
Species: Hu, Mu, Ch
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
NBP2-32665
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-33177
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20881
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89727
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP1-84158
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-90201
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD

Publications for Alix Antibody (NBP1-90201) (0)

There are no publications for Alix Antibody (NBP1-90201).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for Alix Antibody (NBP1-90201) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Rat.

Reviews using NBP1-90201:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Rat
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot Alix NBP1-90201
Enlarge
reviewed by:
Anonymous
WB Rat 01/17/2018
View

Summary

ApplicationWestern Blot
Sample TestedRat astrocytes
SpeciesRat
LotA114984

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Alix Antibody (NBP1-90201) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Alix Antibody (NBP1-90201)

Discover related pathways, diseases and genes to Alix Antibody (NBP1-90201). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Alix Antibody (NBP1-90201)

Discover more about diseases related to Alix Antibody (NBP1-90201).
 

Pathways for Alix Antibody (NBP1-90201)

View related products by pathway.

PTMs for Alix Antibody (NBP1-90201)

Learn more about PTMs related to Alix Antibody (NBP1-90201).

Blogs on Alix.

Tools for Isolation, Quantification and Analysis of Exosomes
Exosomes are spherical to cup-shaped bilayered membrane enclosed nanosize vesicles (30-100 nm) which have the ability to shuttle active cargoes between cells. Johnstone et al. 1987 pioneered in documenting the generation of exosomes in differentiat...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Anonymous
01/17/2018
Application: WB
Species: Rat

Bioinformatics

Gene Symbol PDCD6IP