VPS24 Antibody

Images

 
Western Blot: VPS24 Antibody [NBP1-89391] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: VPS24 Antibody [NBP1-89391] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

VPS24 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:AMQSLVKIPEIQATMRELSKEMMKAGIIEEMLEDTFESMDDQEEMEEEAEMEIDRILFEITAGALGKAPSKVTDALPEPEPPGAMAASEDEEEEEEALEAMQSRLATLR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CHMP3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
VPS24 Protein (NBP1-89391PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for VPS24 Antibody

  • CGI-149
  • CHMP325.1 protein
  • Chromatin-modifying protein 3
  • hVps24
  • member 3,25.1
  • NEDFFLJ38114
  • vacuolar protein sorting 24 (yeast)
  • vacuolar protein sorting 24 homolog (S. cerevisiae)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-57242
Species: Hu
Applications: WB, ICC/IF
NBP1-91780
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
AF5650
Species: Hu
Applications: WB, IHC
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-49557
Species: Hu
Applications: IHC, IHC-P
NBP1-91782
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83726
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-32449
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB200-112
Species: Hu, Mu, Rt, Ha, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KO
H00009146-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
AF6008
Species: Hu, Mu, Rt
Applications: WB
H00005119-B02P
Species: Hu
Applications: WB, ICC/IF
AF6567
Species: Hu, Mu
Applications: WB, IHC
NBP2-37986
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89490
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00006430-B01P
Species: Hu, Rt
Applications: WB, ICC/IF, IHC-P
NBP1-92435
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-65678
Species: Hu, Mu, Rt, Xp
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-20881
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for VPS24 Antibody (NBP1-89391) (0)

There are no publications for VPS24 Antibody (NBP1-89391).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VPS24 Antibody (NBP1-89391) (0)

There are no reviews for VPS24 Antibody (NBP1-89391). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for VPS24 Antibody (NBP1-89391) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional VPS24 Products

Bioinformatics Tool for VPS24 Antibody (NBP1-89391)

Discover related pathways, diseases and genes to VPS24 Antibody (NBP1-89391). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VPS24 Antibody (NBP1-89391)

Discover more about diseases related to VPS24 Antibody (NBP1-89391).
 

Pathways for VPS24 Antibody (NBP1-89391)

View related products by pathway.

PTMs for VPS24 Antibody (NBP1-89391)

Learn more about PTMs related to VPS24 Antibody (NBP1-89391).

Blogs on VPS24

There are no specific blogs for VPS24, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our VPS24 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CHMP3