Von Willebrand Factor Recombinant Protein Antigen

Images

 
There are currently no images for Von Willebrand Factor Protein (NBP1-84761PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Von Willebrand Factor Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human VWF.

Source: E. coli

Amino Acid Sequence: RITLLLMASQEPQRMSRNFVRYVQGLKKKKVIVIPVGIGPHANLKQIRLIEKQAPENKAFVLSSVDELEQQRDEIVSYLCDLAPEAPPPTLPPDMAQVTVGPGLLGVSTLGPKRNSMVLDVAFVL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
VWF
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84761.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Von Willebrand Factor Recombinant Protein Antigen

  • coagulation factor VIII VWF
  • F8
  • F8VWF
  • von Willebrand factor
  • VWD
  • vWF

Background

The glycoprotein encoded by this gene functions as both an antihemophilic factor carrier and a platelet-vessel wall mediator in the blood coagulation system. It is crucial to the hemostasis process. Mutations in this gene or deficiencies in this protein result in von Willebrand's disease. An unprocessed pseudogene has been found on chromosome 22.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-91761
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
DADT130
Species: Hu
Applications: ELISA
NB100-91761
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
DVE00
Species: Hu
Applications: ELISA
DSE100
Species: Hu
Applications: ELISA
AF3628
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
137-PS
Species: Hu
Applications: BA
DY1707
Species: Hu
Applications: ELISA
NB110-68136
Species: Fe, Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
AF1148
Species: Hu
Applications: CyTOF-ready, Flow, Simple Western, WB
DTPA00
Species: Hu
Applications: ELISA
NBP1-81858
Species: Hu
Applications: IHC,  IHC-P, WB
NB110-41083
Species: Hu
Applications: ELISA, WB
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
M6000B
Species: Mu
Applications: ELISA
AF226
Species: Hu
Applications: WB
AF3894
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, IP, WB
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP1-84761PEP
Species: Hu
Applications: AC

Publications for Von Willebrand Factor Protein (NBP1-84761PEP) (0)

There are no publications for Von Willebrand Factor Protein (NBP1-84761PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Von Willebrand Factor Protein (NBP1-84761PEP) (0)

There are no reviews for Von Willebrand Factor Protein (NBP1-84761PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Von Willebrand Factor Protein (NBP1-84761PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Von Willebrand Factor Products

Research Areas for Von Willebrand Factor Protein (NBP1-84761PEP)

Find related products by research area.

Blogs on Von Willebrand Factor.

Thrombomodulin - A multifunctional protein with roles in inflammation and coagulation
Thrombomodulin, also known as BDCA-3, is a glycosylated transmembrane protein present on the surface of vascular endothelial cells. Thrombomodulin is a high-affinity receptor for thrombin, a key protein in the coagulation cascade. Formation of the...  Read full blog post.

Von Willebrand Factor: An important mediator and carrier of hemostasis
Human Von Willebrand Factor (factor VIII R: Ag) is a 270 kDa multimeric plasma gylcoprotein. Important in the maintenance of hemostasis, it mediates platelet adhesion to injured vessel walls and serves as a carrier and stabilizer for coagulation facto...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Von Willebrand Factor Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol VWF