Von Hippel Lindau Antibody

Western Blot: Von Hippel Lindau Antibody [H00007428-B01P] - Analysis of VHL expression in human placenta.

Western Blot: Von Hippel Lindau Antibody [H00007428-B01P] - Analysis of VHL expression in transfected 293T cell line by VHL polyclonal antibody. Lane 1: VHL transfected lysate(18.92 KDa). Lane 2: Non-transfected lysate.

Product Discontinued

Von Hippel Lindau Antibody Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: VHL (ENSP00000344757, 1 a.a. - 172 a.a.) full-length human protein. MPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD
• Specificity: VHL - von Hippel-Lindau tumor suppressor,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: VHL
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Von Hippel Lindau Antibody

• elongin binding protein
• HRCA1
• Protein G7
• pVHL
• RCA1
• VHL
• VHL1
• von Hippel-Lindau disease tumor suppressor
• von Hippel-Lindau syndrome
• von Hippel-Lindau tumor suppressor

Background

Von Hippel-Lindau syndrome (VHL) is a dominantly inherited familial cancer syndrome predisposing to a variety of malignant and benign tumors. A germline mutation of this gene is the basis of familial inheritance of VHL syndrome. The protein encoded by this gene is a component of the protein complex that includes elongin B, elongin C, and cullin-2, and possesses ubiquitin ligase E3 activity. This protein is involved in the ubiquitination and degradation of hypoxia-inducible-factor (HIF), which is a transcription factor that plays a central role in the regulation of gene expression by oxygen. RNA polymerase II subunit POLR2G/RPB7 is also reported to be a target of this protein. Alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: VHL
• Entrez:
  • 7428(Human)
• Uniprot:
  • ENSP00000344757(Human)