VIPAR Antibody

Images

 
Western Blot: VIPAR Antibody [NBP1-89902] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with a ...read more
Immunohistochemistry-Paraffin: VIPAR Antibody [NBP1-89902] - Immunohistochemical staining of human esophagus shows strong cytoplasmic positivity in squamous epithelial cells.

Product Details

Summary
Reactivity Hu, Mouse, RatSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit

Order Details

VIPAR Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:AHIQDHYTLLERQIIIEANDRHLESAGQTEIFRKHPRKASILNMPLVTTLFYSCFYHYTEAEGTFSSPVNLKKTFKIPDKQYVLTALAARAKLRAWNDVDALFTTKNWLGYTKKRAPIGFHRVVEILHKNNAPVQILQEYVNLVEDVDTK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
VIPAS39
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended.
Control Peptide
VIPAR Protein (NBP1-89902PEP)

Alternate Names for VIPAR Antibody

  • C14orf133FLJ12707
  • hSPE-39
  • Protein spe-39 homolog
  • SPE-39
  • SPE39chromosome 14 open reading frame 133
  • VPS16B
  • VPS33B interacting protein, apical-basolateral polarity regulator
  • VPS33B-interacting protein involved in polarity and apical protein restriction
  • VPS33B-interacting protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20874
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86731
Species: Hu
Applications: ICC/IF, IHC, IHC-P
BAM1448
Species: Hu
Applications: Flow, IHC, ICC
AF2605
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP2-41753
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-56929
Species: Hu
Applications: WB, IHC, IHC-P
H00006241-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
MAB8978
Species: Hu, Mu, Rt
Applications: WB
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, ICC
NBP1-76775
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-20872
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31691
Species: Hu
Applications: WB, IHC, IHC-P
AF1029
Species: Mu
Applications: WB, IHC, IP
AF7417
Species: Hu
Applications: WB
NBP1-86944
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-89902
Species: Hu, Mouse, Rat
Applications: WB, IHC, IHC-P

Publications for VIPAR Antibody (NBP1-89902) (0)

There are no publications for VIPAR Antibody (NBP1-89902).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VIPAR Antibody (NBP1-89902) (0)

There are no reviews for VIPAR Antibody (NBP1-89902). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for VIPAR Antibody (NBP1-89902) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional VIPAR Antibody Products

Related Products by Gene

Bioinformatics Tool for VIPAR Antibody (NBP1-89902)

Discover related pathways, diseases and genes to VIPAR Antibody (NBP1-89902). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on VIPAR

There are no specific blogs for VIPAR, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol VIPAS39

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-89902 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought