WFS1 Antibody

Images

 
Immunohistochemistry-Paraffin: WFS1 Antibody [NBP1-84265] - Staining of human heart muscle shows moderate cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

WFS1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KHPCHIKKFDRYKFEITVGMPFSSGADGSRSREEDDVTKDIVLRASSEFKSVLLSLRQGSLIEFSTILEGRLGSKWPVFELKAISCLNCMAQLSPTRRHVKIEHDW
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
WFS1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
WFS1 Protein (NBP1-84265PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%), Rat (84%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for WFS1 Antibody

  • DFNA14
  • DFNA38
  • DFNA6
  • DIDMOAD
  • FLJ51211
  • WFRS
  • WFS1
  • WFSwolframin
  • Wolfram syndrome 1 (wolframin)
  • Wolframin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
H00006934-M06
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-02627
Species: Hu, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF7318
Species: Hu
Applications: IHC
NBP1-32796
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00003087-M02
Species: Hu
Applications: WB, ELISA
NBP1-00206
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-89680
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-84809
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-2076
Species: Hu, Po, Ca, Fe, Gt, GP, Sh
Applications: WB, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB110-60935
Species: Hu, Mu, Pm
Applications: WB
NB600-230
Species: Hu
Applications: WB
NBP2-12897
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
NBP2-57403
Species: Hu
Applications: WB, ICC/IF
NBP1-84266
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
MAB6798
Species: Hu
Applications: WB, ICC
NBP1-84265
Species: Hu
Applications: IHC, IHC-P

Publications for WFS1 Antibody (NBP1-84265) (0)

There are no publications for WFS1 Antibody (NBP1-84265).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WFS1 Antibody (NBP1-84265) (0)

There are no reviews for WFS1 Antibody (NBP1-84265). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for WFS1 Antibody (NBP1-84265) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional WFS1 Products

Bioinformatics Tool for WFS1 Antibody (NBP1-84265)

Discover related pathways, diseases and genes to WFS1 Antibody (NBP1-84265). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for WFS1 Antibody (NBP1-84265)

Discover more about diseases related to WFS1 Antibody (NBP1-84265).
 

Pathways for WFS1 Antibody (NBP1-84265)

View related products by pathway.

PTMs for WFS1 Antibody (NBP1-84265)

Learn more about PTMs related to WFS1 Antibody (NBP1-84265).
 

Research Areas for WFS1 Antibody (NBP1-84265)

Find related products by research area.

Blogs on WFS1

There are no specific blogs for WFS1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our WFS1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol WFS1
Entrez