WFS1 Antibody

Images

 
Immunohistochemistry-Paraffin: WFS1 Antibody [NBP1-84265] - Staining of human Pancreas shows strong granular cytoplasmic positivity in islets of Langerhans.
Immunohistochemistry-Paraffin: WFS1 Antibody [NBP1-84265] - Staining of human Heart muscle shows strong granular cytoplasmic positivity in cardiomyocytes.
Immunohistochemistry-Paraffin: WFS1 Antibody [NBP1-84265] - Staining of human Lung shows strong granular cytoplasmic positivity in pneumocytes.
Immunohistochemistry-Paraffin: WFS1 Antibody [NBP1-84265] - Staining of human Testis shows strong granular cytoplasmic positivity in cells in seminiferous ducts and leydig cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

WFS1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KHPCHIKKFDRYKFEITVGMPFSSGADGSRSREEDDVTKDIVLRASSEFKSVLLSLRQGSLIEFSTILEGRLGSKWPVFELKAISCLNCMAQLSPTRRHVKIEHDW
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
WFS1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
WFS1 Protein (NBP1-84265PEP)
Reviewed Applications
Read 1 Review rated 3
using
NBP1-84265 in the following applications:

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for WFS1 Antibody

  • DFNA14
  • DFNA38
  • DFNA6
  • DIDMOAD
  • FLJ51211
  • WFRS
  • WFS1
  • WFSwolframin
  • Wolfram syndrome 1 (wolframin)
  • Wolframin

Background

Wolframin (WFS1) is a multipass endoplasmic reticulum (ER) membrane protein that plays an important role in maintaining homeostasis of the ER in the pancreas. WFS1 helps to regulate cellular calcium cation homeostasis by altering the filling state of the ER calcium cation store.

WFS1 is the major component of Wolfram syndrome, a rare form of juvenile diabetes, also known as diabetes insipidus and mellitus with optic atrophy and deafness syndrome (DIDMOAD). WFS1 is normally up-regulated during insulin secretion, and inactivation of the protein causes ER stress. In turn, chronic ER stress is thought to play a major role in Wolfram syndrome.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
H00006934-M06
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-02627
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-41304
Species: Hu, Po, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
MAB7936
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow
NBP1-32796
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
H00003087-M02
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP1-00206
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP1-89680
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-84809
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-2076
Species: Bv, Fe, Hu, Rb
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB110-60935
Species: Ch, Hu, Mu, Pm
Applications: IB, IHC, WB
NB600-231
Species: Hu
Applications: IHC, IHC-P, KD, WB
NBP2-12897
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
NBP1-06274
Species: Ce, Ch, Dr, Hu, Mu, Rt, Sh, Ze
Applications: Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, Simple Western, WB
NBP3-13885
Species: Hu
Applications: Flow, ICC/IF, IHC-P, IP, PA, WB
NBP2-93677
Species: Hu, Mu, Rt
Applications: WB
NBP2-45603
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB

Publications for WFS1 Antibody (NBP1-84265) (0)

There are no publications for WFS1 Antibody (NBP1-84265).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for WFS1 Antibody (NBP1-84265) (1) 31

Average Rating: 3
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-84265:
Filter by Applications
ICC
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
  3
reviewed by:
Amleto Fiocchi
ICC Human 06/07/2019
View

Summary

ApplicationImmunocytochemistry
Sample Testedfibroblasts
SpeciesHuman
Lota113901

Comments

Commentsprimary ab 1:100; detection with Polymer-HRP.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for WFS1 Antibody (NBP1-84265) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional WFS1 Products

Bioinformatics Tool for WFS1 Antibody (NBP1-84265)

Discover related pathways, diseases and genes to WFS1 Antibody (NBP1-84265). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for WFS1 Antibody (NBP1-84265)

Discover more about diseases related to WFS1 Antibody (NBP1-84265).
 

Pathways for WFS1 Antibody (NBP1-84265)

View related products by pathway.

PTMs for WFS1 Antibody (NBP1-84265)

Learn more about PTMs related to WFS1 Antibody (NBP1-84265).
 

Research Areas for WFS1 Antibody (NBP1-84265)

Find related products by research area.

Blogs on WFS1

There are no specific blogs for WFS1, but you can read our latest blog posts.
Download our IHC Handbook

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

3
5
0
4
0
3
1
2
0
1
0

 
Amleto Fiocchi
06/07/2019
Application: ICC
Species: Human

Bioinformatics

Gene Symbol WFS1