VGLUT2 Antibody - Azide and BSA Free

Western Blot: VGLUT2 Antibody [NBP2-94571] - Analysis of extracts of various cell lines, using VGLUT2 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 10s.

Immunocytochemistry/ Immunofluorescence: VGLUT2 Antibody - Azide and BSA Free [NBP2-94571] - Immunofluorescence analysis of rat brain using VGLUT2 Rabbit pAb (A15177) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: VGLUT2 Antibody - Azide and BSA Free [NBP2-94571] - Immunofluorescence analysis of mouse brain using VGLUT2 Rabbit pAb (A15177) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

VGLUT2 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit VGLUT2 Antibody - Azide and BSA Free (NBP2-94571) is a polyclonal antibody validated for use in IHC, WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 500-582 of human VGLUT2 (NP_065079.1). GEKQPWADPEETSEEKCGFIHEDELDEETGDITQNYINYGTTKSYGATTQANGGWPSGWEKKEEFVQGEVQDSHSYKDRVDYS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC17A6
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 64 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for VGLUT2 Antibody - Azide and BSA Free

• differentiation-associated BNPI
• differentiation-associated Na(+)-dependent inorganic phosphate cotransporter
• differentiation-associated Na-dependent inorganic phosphate cotransporter
• DNPI
• solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 6
• solute carrier family 17 member 6
• vesicular glutamate transporter 2
• VGLUT2

Background

VGLUT2 is a sodium dependent inorganic phosphate cotransporter that is involved in the calcium dependent glutamate release from astrocytes. It is expressed in only a subset of neurons, localized to synaptic vesicles, at synapses exhibiting classical excitatory features. VGLUT2 mRNA is found in brain regions that lack VGLUT1, a related protein also displaying sodium dependent inorganic phosphate cotransporter activity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC17A6