VEGFR2/KDR/Flk-1 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

VEGFR2/KDR/Flk-1 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human VEGFR2/KDR/Flk-1
  
  

  Source: E.coli

  Amino Acid Sequence: TARTELNVGIDFNWEYPSSKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGVTRSDQGLYTCAASSGLMTKKNSTFVRVHEKPFVAFGSGMESLVEA

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: KDR
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-25223It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for VEGFR2/KDR/Flk-1 Recombinant Protein Antigen

• CD309 antigen
• CD309
• EC 2.7.10
• EC 2.7.10.1
• Fetal liver kinase 1
• fetal liver kinase-1
• Flk1
• Flk-1
• FLK1tyrosine kinase growth factor receptor
• KDR
• kinase insert domain receptor (a type III receptor tyrosine kinase)
• Kinase insert domain receptor
• KRD1
• Ly73
• Protein-tyrosine kinase receptor flk-1
• soluble VEGFR2
• vascular endothelial growth factor receptor 2
• VEGF R2
• VEGFR
• VEGFR2
• VEGFR-2

Background

Vascular endothelial growth factor receptor 2 (VEGFR2) is a member of a receptor tyrosine kinase family whose activation plays an essential role in a large number of biological processes such as embryonic development, wound healing, cell proliferation, migration and differentiation. Like other common growth factor receptors, VEGF receptor 2 dimerises upon ligand binding and is autophosphorylated at multiple tyrosine residues. These sites can be involved in the regulation of kinase activity or can serve as binding sites for SH2 and phosphotyrosine binding containing signaling proteins. Phosphorylation of Tyrosines 1054 and 1059 in the activation loop is required for activation of VEGF receptor 2 and its intrinsic tyrosine kinase activity.

Defects in the VEGFR2 gene are associated with susceptibility to benign, highly proliferative lesions involving aberrant localized growth of capillary endothelium called hemangioma capillary infantile. HCI is the most common tumor found in infants, found in up to 10% of all births.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KDR