We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

VEGFR2/KDR/Flk-1 Recombinant Protein Antigen

Images

 
There are currently no images for VEGFR2/KDR/Flk-1 Recombinant Protein Antigen (NBP3-25223PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

VEGFR2/KDR/Flk-1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human VEGFR2/KDR/Flk-1

Source: E.coli

Amino Acid Sequence: TARTELNVGIDFNWEYPSSKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGVTRSDQGLYTCAASSGLMTKKNSTFVRVHEKPFVAFGSGMESLVEA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Protein/Peptide Type
Recombinant Protein Antigen
Gene
KDR
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-25223It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for VEGFR2/KDR/Flk-1 Recombinant Protein Antigen

  • CD309 antigen
  • CD309
  • EC 2.7.10
  • EC 2.7.10.1
  • Fetal liver kinase 1
  • fetal liver kinase-1
  • Flk1
  • Flk-1
  • FLK1tyrosine kinase growth factor receptor
  • KDR
  • kinase insert domain receptor (a type III receptor tyrosine kinase)
  • Kinase insert domain receptor
  • KRD1
  • Ly73
  • Protein-tyrosine kinase receptor flk-1
  • soluble VEGFR2
  • vascular endothelial growth factor receptor 2
  • VEGF R2
  • VEGFR
  • VEGFR2
  • VEGFR-2

Background

Vascular endothelial growth factor receptor 2 (VEGFR2) is a member of a receptor tyrosine kinase family whose activation plays an essential role in a large number of biological processes such as embryonic development, wound healing, cell proliferation, migration and differentiation. Like other common growth factor receptors, VEGF receptor 2 dimerises upon ligand binding and is autophosphorylated at multiple tyrosine residues. These sites can be involved in the regulation of kinase activity or can serve as binding sites for SH2 and phosphotyrosine binding containing signaling proteins. Phosphorylation of Tyrosines 1054 and 1059 in the activation loop is required for activation of VEGF receptor 2 and its intrinsic tyrosine kinase activity.

Defects in the VEGFR2 gene are associated with susceptibility to benign, highly proliferative lesions involving aberrant localized growth of capillary endothelium called hemangioma capillary infantile. HCI is the most common tumor found in infants, found in up to 10% of all births.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DVE00
Species: Hu
Applications: ELISA
AF321
Species: Hu
Applications: Block, CyTOF-ready, Flow, IHC, WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
NB600-1071
Species: Hu(-), Mu
Applications: COMET, ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, mIF, WB
AF743
Species: Mu
Applications: CyTOF-ready, Flow, WB
AF3628
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NB110-41083
Species: Hu
Applications: ELISA, WB
AF1356
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Simple Western, WB
DPG00
Species: Hu
Applications: ELISA
AF566
Species: Mu, Rt
Applications: Block, CyTOF-ready, Flow, IHC, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
DVEC00
Species: Hu
Applications: ELISA
233-FB
Species: Hu
Applications: BA
AF1042
Species: Mu
Applications: Dual ISH-IHC, IHC, WB
NBP3-25223PEP
Species: Hu
Applications: AC

Publications for VEGFR2/KDR/Flk-1 Recombinant Protein Antigen (NBP3-25223PEP) (0)

There are no publications for VEGFR2/KDR/Flk-1 Recombinant Protein Antigen (NBP3-25223PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VEGFR2/KDR/Flk-1 Recombinant Protein Antigen (NBP3-25223PEP) (0)

There are no reviews for VEGFR2/KDR/Flk-1 Recombinant Protein Antigen (NBP3-25223PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for VEGFR2/KDR/Flk-1 Recombinant Protein Antigen (NBP3-25223PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our VEGFR2/KDR/Flk-1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol KDR