VEGF-D Antibody - BSA Free Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: TGCKCLPTAPRHPYSIIRRSIQIPEEDRCSHSKKLCPIDMLWDSNKCKCVLQEENPLAGTEDHSHLQEPALCGPHMMFDEDRCECVCKTPCPKDLIQHPKNCSCFECKESLETCCQKHKLFHPDT |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
VEGFD |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
- Western Blot 0.04-0.4 ug/ml
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Control Peptide |
|
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (89%)
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for VEGF-D Antibody - BSA Free
Background
Vascular Endothelial Growth Factor D (VEGFD), also known as c-fos-induced growth factor (FIGF), is a member of the VEGF family of growth factors. Vascular endothelial growth factors (VEGFs) are a family of closely related growth factors having a conserved pattern of eight cysteine residues and sharing common VEGF receptors. VEGFs stimulate endothelial cells, induce angiogenesis, promote cell migration, increase vascular permeability, and inhibit apoptosis. VEGFD is most closely related to VEGFC (23.3% amino acid sequence identity) and has a similar VEGF homology domain that spans the middle third of the precursor protein and the long N-terminal and C-terminal extensions. In adults, VEGFD is highly expressed in lung, heart, muscle, and small intestine. VEGFD expression in fibroblasts is induced by cell interaction mediated by cadherin 11. Recombinant human VEGFD is a ligand for the tyrosine kinases, VEGFR2 (Flk1) and VEGF receptor 3 (Flt4). Since VEGFR3 is strongly expressed in lymphatic endothelial cells, it is postulated that VEGFD is involved in the regulation of the growth and/or differentiation of lymphatic endothelium and thus, a mitogen for endothelial cells.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Mu
Applications: CyTOF-ready, Flow, WB
Species: Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Neut, WB
Species: Mu
Applications: Dual ISH-IHC, IHC, WB
Species: Hu
Applications: Block, CyTOF-ready, Flow, IHC, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: WB
Species: Mu
Applications: IHC, Simple Western, WB
Species: Hu
Applications: WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Publications for VEGF-D Antibody (NBP1-86865) (0)
There are no publications for VEGF-D Antibody (NBP1-86865).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for VEGF-D Antibody (NBP1-86865) (0)
There are no reviews for VEGF-D Antibody (NBP1-86865).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for VEGF-D Antibody (NBP1-86865) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional VEGF-D Products
Research Areas for VEGF-D Antibody (NBP1-86865)
Find related products by research area.
|
Blogs on VEGF-D