VEGF-D Antibody

Images

 
Western Blot: VEGF-D Antibody [NBP1-86865] - Analysis in control (vector only transfected HEK293T lysate) and fIGF over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: VEGF-D Antibody [NBP1-86865] - Staining of human heart muscle shows strong positivity in intercalated discs.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

VEGF-D Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TGCKCLPTAPRHPYSIIRRSIQIPEEDRCSHSKKLCPIDMLWDSNKCKCVLQEENPLAGTEDHSHLQEPALCGPHMMFDEDRCECVCKTPCPKDLIQHPKNCSCFECKESLETCCQKHKLFHPDT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FIGF
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
VEGF-D Protein (NBP1-86865PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for VEGF-D Antibody

  • c-fos induced growth factor (vascular endothelial growth factor D)
  • FIGF
  • vascular endothelial growth factor D
  • VEGFD
  • VEGF-D
  • VEGF-DVEGFDc-Fos-induced growth factor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF743
Species: Mu
Applications: WB, Flow, CyTOF-ready
AF644
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NB600-1015
Species: Mu, Hu(-)
Applications: WB, EM, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-86865
Species: Hu
Applications: WB, IHC, IHC-P

Publications for VEGF-D Antibody (NBP1-86865) (0)

There are no publications for VEGF-D Antibody (NBP1-86865).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VEGF-D Antibody (NBP1-86865) (0)

There are no reviews for VEGF-D Antibody (NBP1-86865). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for VEGF-D Antibody (NBP1-86865) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional VEGF-D Products

Bioinformatics Tool for VEGF-D Antibody (NBP1-86865)

Discover related pathways, diseases and genes to VEGF-D Antibody (NBP1-86865). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VEGF-D Antibody (NBP1-86865)

Discover more about diseases related to VEGF-D Antibody (NBP1-86865).
 

Pathways for VEGF-D Antibody (NBP1-86865)

View related products by pathway.

PTMs for VEGF-D Antibody (NBP1-86865)

Learn more about PTMs related to VEGF-D Antibody (NBP1-86865).
 

Research Areas for VEGF-D Antibody (NBP1-86865)

Find related products by research area.

Blogs on VEGF-D

There are no specific blogs for VEGF-D, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our VEGF-D Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FIGF
Entrez