We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

VCAM-1/CD106 Recombinant Protein Antigen

Images

 
There are currently no images for VCAM-1/CD106 Recombinant Protein Antigen (NBP2-55858PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

VCAM-1/CD106 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human VCAM-1/CD106.

Source: E. coli

Amino Acid Sequence: ITVKCSVADVYPFDRLEIDLLKGDHLMKSQEFLEDADRKSLETKSLEVTFTPVIEDIGKVLVCRAKLHIDEMDSVPT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
VCAM1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55858.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for VCAM-1/CD106 Recombinant Protein Antigen

  • CD106 antigen
  • CD106
  • DKFZp779G2333
  • INCAM-100
  • L1CAM
  • MGC99561
  • vascular cell adhesion molecule 1
  • vascular cell adhesion protein 1
  • V-CAM 1
  • VCAM1
  • VCAM-1

Background

CD106 is a 110 kD glycosylphosphatidylinositol (GPI)-linked transmembrane protein, also known as VCAM-1 and INCAM-110. It is constitutively expressed on bone marrow stromal cells, myeloid progenitors, splenic dendritic cells, activated endothelial cells, as well as some lymphocytes. CD106 expression can be upregulated on endothelial cells by inflammatory cytokines. CD106 is involved in adhesion and acts as a counter-receptor for VLA-4 ( alpha4/ beta1 integrin) and LPAM-1 ( alpha4/ beta7 integrin). The 429 antibody has been reported to partially block VCAM-1-mediated binding.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF796
Species: Mu
Applications: AdBlk, IHC, WB
BBA16
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, WB
M6000B
Species: Mu
Applications: ELISA
7268-CT
Species: Hu
Applications: BA
DCP00
Species: Hu
Applications: ELISA
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
AF3628
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
BBA10
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, KO, Simple Western, WB
137-PS
Species: Hu
Applications: BA
AF1730
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC
MAB3595
Species: Hu
Applications: CyTOF-ready, Flow, Simple Western, WB
MAB17781
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, IP, KO
DY1707
Species: Hu
Applications: ELISA
AF4117
Species: Rt
Applications: IHC, WB
AF1320
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NB110-41083
Species: Hu
Applications: ELISA, WB
DVE00
Species: Hu
Applications: ELISA
NBP2-55858PEP
Species: Hu
Applications: AC

Publications for VCAM-1/CD106 Recombinant Protein Antigen (NBP2-55858PEP) (0)

There are no publications for VCAM-1/CD106 Recombinant Protein Antigen (NBP2-55858PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VCAM-1/CD106 Recombinant Protein Antigen (NBP2-55858PEP) (0)

There are no reviews for VCAM-1/CD106 Recombinant Protein Antigen (NBP2-55858PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for VCAM-1/CD106 Recombinant Protein Antigen (NBP2-55858PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional VCAM-1/CD106 Products

Research Areas for VCAM-1/CD106 Recombinant Protein Antigen (NBP2-55858PEP)

Find related products by research area.

Blogs on VCAM-1/CD106

There are no specific blogs for VCAM-1/CD106, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our VCAM-1/CD106 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol VCAM1