VCAM-1/CD106 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human VCAM-1/CD106. Source: E. coli Amino Acid Sequence: ITVKCSVADVYPFDRLEIDLLKGDHLMKSQEFLEDADRKSLETKSLEVTFTPVIEDIGKVLVCRAKLHIDEMDSVPT Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
VCAM1 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55858. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
26 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for VCAM-1/CD106 Recombinant Protein Antigen
Background
CD106 is a 110 kD glycosylphosphatidylinositol (GPI)-linked transmembrane protein, also known as VCAM-1 and INCAM-110. It is constitutively expressed on bone marrow stromal cells, myeloid progenitors, splenic dendritic cells, activated endothelial cells, as well as some lymphocytes. CD106 expression can be upregulated on endothelial cells by inflammatory cytokines. CD106 is involved in adhesion and acts as a counter-receptor for VLA-4 ( alpha4/ beta1 integrin) and LPAM-1 ( alpha4/ beta7 integrin). The 429 antibody has been reported to partially block VCAM-1-mediated binding.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: AdBlk, IHC, WB
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, WB
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, KO, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC
Species: Hu
Applications: CyTOF-ready, Flow, Simple Western, WB
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, IP, KO
Species: Hu
Applications: ELISA
Species: Rt
Applications: IHC, WB
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu
Applications: ELISA, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: AC
Publications for VCAM-1/CD106 Recombinant Protein Antigen (NBP2-55858PEP) (0)
There are no publications for VCAM-1/CD106 Recombinant Protein Antigen (NBP2-55858PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for VCAM-1/CD106 Recombinant Protein Antigen (NBP2-55858PEP) (0)
There are no reviews for VCAM-1/CD106 Recombinant Protein Antigen (NBP2-55858PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for VCAM-1/CD106 Recombinant Protein Antigen (NBP2-55858PEP) (0)
Additional VCAM-1/CD106 Products
Research Areas for VCAM-1/CD106 Recombinant Protein Antigen (NBP2-55858PEP)
Find related products by research area.
|
Blogs on VCAM-1/CD106