We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

beta Sarcoglycan Antibody - BSA Free

Images

 
Orthogonal Strategies: Analysis in human heart muscle and pancreas tissues using NBP1-90300 antibody. Corresponding SGCB RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: beta Sarcoglycan Antibody [NBP1-90300] - Staining of human heart muscle shows strong membranous and cytoplasmic positivity in cardiomyocytes.
Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: beta Sarcoglycan Antibody [NBP1-90300] - Staining of human prostate shows very weak membranous positivity in smooth muscle cells.
Immunohistochemistry-Paraffin: beta Sarcoglycan Antibody [NBP1-90300] - Staining of human skeletal muscle shows moderate membranous positivity in myocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free
Validated by:
       

Orthogonal Strategies

 

Order Details

View Available Formulations
Catalog# & Formulation Size Price

beta Sarcoglycan Antibody - BSA Free Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: FHMGGNMELKAENSIILNGSVMVSTTRLPSSSSGDQLGSGDWVRYKLCMCADGTLFKVQVTSQNMGCQISDNPCGNTH
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SGCB
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. WB use reported with previous lot in PMIDs: 28284983 and 26214262).
Control Peptide
beta Sarcoglycan Protein (NBP1-90300PEP)
Publications
Read Publications using
NBP1-90300 in the following applications:

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (88%). Mouse reactivity reported in scientific literature (PMIDs : 29712757, 28284983, 26214262).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for beta Sarcoglycan Antibody - BSA Free

  • 43 kDa dystrophin-associated glycoprotein
  • 43DAG
  • A3b
  • A3bbeta-SG
  • beta Sarcoglycan
  • beta-Sarcoglycan
  • beta-sarcoglycan(43kD dystrophin-associated glycoprotein)
  • Beta-SG
  • LGMD2E
  • limb girdle muscular dystrophy 2E (non-linked families)
  • Sarcoglycan beta
  • sarcoglycan, beta (43kD dystrophin-associated glycoprotein)
  • sarcoglycan, beta (43kDa dystrophin-associated glycoprotein)
  • SGC
  • SGCB

Background

The dystrophin-glycoprotein complex (DGC) is a multisubunit protein complex that spans the sarcolemma and provides structural linkage between the subsarcolemmal cytoskeleton and the extracellular matrix of muscle cells. There are 3 main subcomplexes of the DGC: the cytoplasmic proteins dystrophin (DMD; MIM 300377) and syntrophin (SNTA1; MIM 601017), the alpha- and beta-dystroglycans (see MIM 128239), and the sarcoglycans (see, e.g., SGCA; MIM 600119) (Crosbie et al., 2000 [PubMed 10942431]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-605
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, In vitro, WB
NB100-858
Species: Gp, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-WhMt, IHC, IHC-Fr,  IHC-P, PEP-ELISA, WB
NB300-500
Species: Am, Bv, Ca, Dr, Hu, Mu, Po, Rt, Sh
Applications: IHC, IHC-Fr,  IHC-P, WB
NBP2-02521
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-67150
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr,  IHC-P, IP, WB
AF6868
Species: Hu
Applications: IHC, KO, WB
NBP1-90299
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-89953
Species: Hu
Applications: IHC,  IHC-P
NBP1-97507
Species: Bv, Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP2-47415
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-33714
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC-WhMt, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP2-00555
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-76919
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
H00006444-M01-100ug
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
NBP1-76917
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-15343
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-35199
Species: Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP1-86139
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-90300
Species: Hu
Applications: IHC

Publications for beta Sarcoglycan Antibody (NBP1-90300)(7)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 3 applications: IF/IHC, WB, Western Blot.


Filter By Application
IF/IHC
(1)
WB
(2)
Western Blot
(2)
All Applications
Filter By Species
Mouse
(5)
All Species
Showing Publications 1 - 7 of 7.
Publications using NBP1-90300 Applications Species
Davy Vanhoutte, Tobias G. Schips, Rachel A. Minerath, Jiuzhou Huo, Naga Swathi Sree Kavuri, Vikram Prasad, Suh-Chin Lin, Michael J. Bround, Michelle A. Sargent, Christopher M. Adams, Jeffery D. Molkentin Thbs1 regulates skeletal muscle mass in a TGF beta -Smad2/3-ATF4-dependent manner Cell reports 2024-06-26 [PMID: 38678560]
Baumann CW, Lindsay A, Sidky SR et al. Contraction-Induced Loss of Plasmalemmal Electrophysiological Function Is Dependent on the Dystrophin Glycoprotein Complex Frontiers in Physiology 2021-10-26 [PMID: 34764884] (Western Blot, Mouse) Western Blot Mouse
Sidky SR, Ingalls CP, Lowe DA, Baumann CW. Membrane Proteins Increase with the Repeated Bout Effect Medicine & Science in Sports & Exercise 2022-01-01 [PMID: 34334717] (Western Blot, Mouse) Western Blot Mouse
Brody MJ, Vanhoutte D, Schips TG et al. Defective Flux of Thrombospondin-4 through the Secretory Pathway Impairs Cardiomyocyte Membrane Stability and Causes Cardiomyopathy Mol. Cell. Biol. 2018-04-30 [PMID: 29712757] (Mouse) Mouse
Pozsgai ER, Griffin DA, Heller KN et al. Systemic AAV-Mediated b-Sarcoglycan Delivery Targeting Cardiac and Skeletal Muscle Ameliorates Histological and Functional Deficits in LGMD2E Mice. Mol. Ther. 2017-03-08 [PMID: 28284983] (WB, Mouse) WB Mouse
Vanhoutte D, Schips TG, Kwong JQ et al. Thrombospondin expression in myofibers stabilizes muscle membranes. Elife 2016-09-26 [PMID: 27669143] (IF/IHC) IF/IHC
Pozsgai ER, Griffin DA, Heller KN et al. b-Sarcoglycan gene transfer decreases fibrosis and restores force in LGMD2E mice. Gene Ther. 2015-08-20 [PMID: 26214262] (WB, Mouse) WB Mouse

Reviews for beta Sarcoglycan Antibody (NBP1-90300) (0)

There are no reviews for beta Sarcoglycan Antibody (NBP1-90300). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for beta Sarcoglycan Antibody (NBP1-90300) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional beta Sarcoglycan Products

Research Areas for beta Sarcoglycan Antibody (NBP1-90300)

Find related products by research area.

Blogs on beta Sarcoglycan

There are no specific blogs for beta Sarcoglycan, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our beta Sarcoglycan Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol SGCB
Entrez
Uniprot