Home » beta Sarcoglycan » beta Sarcoglycan Research Products » beta Sarcoglycan Antibody

beta Sarcoglycan Antibody

 (4 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: beta Sarcoglycan Antibody [NBP1-90300] - Staining in human heart muscle and pancreas tissues using NBP1-90300 antibody. Corresponding SGCB RNA-seq data are presented for the same tissues.
Orthogonal Strategies: Immunohistochemistry-Paraffin: beta Sarcoglycan Antibody [NBP1-90300] - Staining in human heart muscle and pancreas tissues using NBP1-90300 antibody. Corresponding SGCB RNA-seq data are ...read more
Immunohistochemistry-Paraffin: beta Sarcoglycan Antibody [NBP1-90300] - Staining of human heart muscle shows strong membranous and cytoplasmic positivity in cardiomyocytes.
Immunohistochemistry-Paraffin: beta Sarcoglycan Antibody [NBP1-90300] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: beta Sarcoglycan Antibody [NBP1-90300] - Staining of human prostate shows very weak membranous positivity in smooth muscle cells.
Immunohistochemistry-Paraffin: beta Sarcoglycan Antibody [NBP1-90300] - Staining of human skeletal muscle shows moderate membranous positivity in myocytes.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

beta Sarcoglycan Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: FHMGGNMELKAENSIILNGSVMVSTTRLPSSSSGDQLGSGDWVRYKLCMCADGTLFKVQVTSQNMGCQISDNPCGNTH
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SGCB
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. WB reactivity reported in (PMID: 28284983).
Control Peptide
beta Sarcoglycan Protein (NBP1-90300PEP)
Publications
Read Publications using
NBP1-90300 in the following applications:

  • IHC
    1 publication
  • WB
    2 publications

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 28284983). Immunogen displays the following percentage of sequence identity for non-tested species: Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for beta Sarcoglycan Antibody

  • 43 kDa dystrophin-associated glycoprotein
  • 43DAG
  • A3b
  • A3bbeta-SG
  • beta Sarcoglycan
  • beta-Sarcoglycan
  • beta-sarcoglycan(43kD dystrophin-associated glycoprotein)
  • Beta-SG
  • LGMD2E
  • limb girdle muscular dystrophy 2E (non-linked families)
  • Sarcoglycan beta
  • sarcoglycan, beta (43kD dystrophin-associated glycoprotein)
  • sarcoglycan, beta (43kDa dystrophin-associated glycoprotein)
  • SGC
  • SGCB

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

iNOS Antibody -
BSA Free
NB300-605
Western Blot: iNOS Antibody [NB300-605] - Analysis of iNOS was performed by loading 20 ug of RAW264 whole cell lysate untreated (left lane) or stimulated with LPS at 1 ug/mL for 16 hours (right lane) and 10 uL of PageRuler Plus Prestained Protein Ladder onto a 4-20% Tris-Glycine polyacrylamide gel. Proteins were transferred to a nitrocellulose membrane and blocked with 5% Milk in TBST for at least 1 hour. The membrane was probed with an iNOS Rabbit polyclonal antibody at a dilution of 1:1000 overnight at 4C on a rocking platform, washed in TBST, and probed with a Goat anti-Rabbit IgG (H+L) Secondary Antibody, HRP conjugate at a dilution of 1:1000 for 1 hour. Chemiluminescent detection was performed using SuperSignal West Pico.
Western Blot: iNOS Antibody [NB300-605] - LCA-induced oxidative stress in 4T1 breast cancer cells. The 4T1 cells were treated with LCA for 48 h, then the indicated measurements were performed. The level of iNOS protein was detected by western blotting (n = 3). Image collected and cropped by CiteAb from the following publication (https://www.mdpi.com/2072-6694/11/9/1255), licensed under a CC-BY licence.
Western Blot: iNOS Antibody [NB300-605] - iNOS in stimulated astrocytes. Western blot image submitted by a verified customer review.
(79 Publications)
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB
nNOS Antibody
NB100-858
Immunocytochemistry/Immunofluorescence: nNOS Antibody [NB100-858] - Immunofluorescence analysis of paraformaldehyde fixed HeLa cells, permeabilized with 0.15% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL), showing membrane, cytoplasmic and nuclear staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL).
Flow Cytometry: nNOS Antibody [NB100-858] - Flow cytometric analysis of paraformaldehyde fixed Kelly cells (blue line), permeabilized with 0.5% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (1 ug/mL). IgG control: Unimmunized goat IgG (black line) followed by Alexa Fluor 488 secondary antibody.
Immunocytochemistry/Immunofluorescence: nNOS Antibody [NB100-858] - Wholemount preparations of the myenteric neurons in the distal colon segments following 3 (2a-2d) and 7 (4a-4d) days of repeated in vivo oxaliplatin administration compared to sham-treated animals at 3 (1a-1d) and 7 (3a-3d) days. Myenteric ganglia and neurons labeled with beta-Tubulin Tuj1 (red), nuclei labeled with DAPI (blue) (arrows) can be seen within the ganglion (1b). Smooth muscle cells (asterisks) are also labeled with DAPI (1b). Significant increase in the proportion of nNOS neurons (green) can be seen at both Days 3 and 7 after oxaliplatin treatment. Scale bar = 20 um. Image collected and cropped by CiteAb from the following publication (www.journal.frontiersin.org/article/10.3389/fnins.2013.00030/abstract) licensed under a CC-BY licence.
(13 Publications)
Species: Gp, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, PEP-ELISA, WB
eNOS Antibody -
BSA Free
NB300-500
Immunohistochemistry: eNOS Antibody [NB300-500] - Staining of representative pulmonary artery endothelial cells from rats subjected to CON=Control Group, ALI=Acute lung injury Group, LV=Low tidal volume Group, VLV=Very low tidal volume Group, MV=Large tidal volume Group. Dark brown staining of indicates eNOS-positive cells. Magnification x400.
Immunohistochemistry-Paraffin: eNOS Antibody [NB300-500] - Expression of endothelial markers indicate functional endothelium in TEVG. Whole mount staining of native aorta and TEVG. VE-cadherin is a marker of cellular borders of endothelial cells (green). Endothelial nitric oxide synthase (eNOS) is a marker of a functional endothelium (red). DAPI is a nuclear stain (blue). Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0120328), licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: eNOS Antibody [NB300-500] - Staining of eNOS in human lung tissue.
(20 Publications)
Species: Am, Bv, Ca, Dr, Hu, Mu, Po, Rt, Sh
Applications: IHC, IHC-Fr, IHC-P, WB
cGK1/PRKG1
Antibody (OTI9G4)
NBP2-02521
Western Blot: cGK1/PRKG1 Antibody (9G4) [NBP2-02521] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY cGK1/PRKG1 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-cGK1/PRKG1.
Immunohistochemistry-Paraffin: cGK1/PRKG1 Antibody (9G4) [NBP2-02521] - Staining of paraffin-embedded Kidney tissue using anti-cGK1/PRKG1 mouse monoclonal antibody.
Immunohistochemistry-Paraffin: cGK1/PRKG1 Antibody (9G4) [NBP2-02521] - Staining of paraffin-embedded pancreas tissue using anti-cGK1/PRKG1 mouse monoclonal antibody.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
alpha-Sarcoglycan
Antibody (3W3Q10)
NBP3-15896
Immunohistochemistry-Paraffin: alpha-Sarcoglycan Antibody (3W3Q10) [NBP3-15896] - Immunohistochemistry of paraffin-embedded rat heart using alpha-Sarcoglycan (SGCA) Rabbit mAb (NBP3-15896) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: alpha-Sarcoglycan Antibody (3W3Q10) [NBP3-15896] - Immunohistochemistry of paraffin-embedded mouse heart using alpha-Sarcoglycan (SGCA) Rabbit mAb (NBP3-15896) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunocytochemistry/Immunofluorescence: alpha-Sarcoglycan Antibody (3W3Q10) [NBP3-15896] - Immunofluorescence analysis of rat heart cells using alpha-Sarcoglycan Rabbit mAb (NBP3-15896) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Dystroglycan
Antibody
NBP2-14868
Western Blot: Dystroglycan Antibody [NBP2-14868] - U87-MG whole cell extracts and membrane extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with DAG1 antibody diluted at 1:500.
Immunocytochemistry/Immunofluorescence: Dystroglycan Antibody [NBP2-14868] - HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: Dystroglycan protein stained by Dystroglycan antibody 38) diluted at 1:1000. Red: alpha Tubulin, a cytoskeleton marker, stained by alpha Tubulin antibody [B-5-1-2] diluted at 1:10000. Blue: Hoechst 33342 staining.
Immunohistochemistry-Paraffin: Dystroglycan Antibody [NBP2-14868] - Mouse placenta. DAG1 stained by Dystroglycan antibody diluted at 1:500. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min.
(2 Publications)
Species: Eq, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
gamma Sarcoglycan
Antibody
NBP1-90299
Immunohistochemistry-Paraffin: gamma Sarcoglycan Antibody [NBP1-90299] - Staining of human heart muscle shows high expression.
Immunohistochemistry-Paraffin: gamma Sarcoglycan Antibody [NBP1-90299] - Staining in human heart muscle and prostate tissues using anti-SGCG antibody. Corresponding SGCG RNA-seq data are presented for the same tissues.
Immunocytochemistry/Immunofluorescence: gamma Sarcoglycan Antibody [NBP1-90299] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Dystrophin Antibody
NBP1-89953
Immunohistochemistry-Paraffin: Dystrophin Antibody [NBP1-89953] - Staining of human heart muscle shows strong membranous positivity in myocytes.
Immunohistochemistry-Paraffin: Dystrophin Antibody [NBP1-89953] - Staining of human skeletal muscle shows strong membranous positivity in myocytes.
Immunohistochemistry-Paraffin: Dystrophin Antibody [NBP1-89953] - Staining of human tonsil shows no positivity as expected.
(4 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
HO-1/HMOX1/HSP32
Antibody (HO-1-1)
NBP1-97507
Flow Cytometry: HO-1/HMOX1/HSP32 Antibody (HO-1-1) [NBP1-97507] - Analysis of 10^6 Jurkat cells stained using HO-1 monoclonal antibody (HO-1-1), (Prod. No. ADI-OSA-110), at a concentration of 50 ug/mL
Immunohistochemistry-Paraffin: HO-1/HMOX1/HSP32 Antibody (HO-1-1) [NBP1-97507] - Analysis of human spleen tissue stained with HO-1, mAb (HO-1-1) at 10ug/ml.
Western Blot: HO-1/HMOX1/HSP32 Antibody (HO-1-1) [NBP1-97507] - Lane 1: MW marker; Lane 2: HO-1 (rat), (recombinant); Lane 3: HO-1 (human), (recombinant); Lane 4: HO-2 (human), (recombinant); Lane 5: MDBK cell lysate; Lane 6: Dog liver microsome; Lane 7: Mouse liver microsome.
(16 Publications)
Species: Bv, Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
ISYNA1 Antibody
NBP2-47415
Immunocytochemistry/Immunofluorescence: ISYNA1 Antibody [NBP2-47415] - Immunofluorescent staining of human cell line HEK 293 shows localization to nucleus & cytosol.
Immunohistochemistry-Paraffin: ISYNA1 Antibody [NBP2-47415] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: ISYNA1 Antibody [NBP2-47415] - Staining of human testis shows high expression.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
SNAP25 Antibody
NBP1-88769
Western Blot: SNAP25 Antibody [NBP1-88769] - Analysis in human cell lines U2OS and MCF-7 using anti-SNAP25 antibody. Corresponding SNAP25 RNA-seq data are presented for the same cell lines. Loading control: anti-GAPDH.
Western Blot: SNAP25 Antibody [NBP1-88769] - Analysis in control (vector only transfected HEK293T lysate) and SNAP25 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: SNAP25 Antibody [NBP1-88769] - Staining of human cerebral cortex shows strong positivity in neuropil.
(4 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
VASP Antibody
(OTI4D6)
NBP2-00555
Flow Cytometry: VASP Antibody (OTI4D6) [NBP2-00555] - Analysis of Hela cells, using anti-VASP antibody, (Red), compared to a nonspecific negative control antibody (Blue).
Flow Cytometry: VASP Antibody (OTI4D6) [NBP2-00555] - Analysis of Jurkat cells, using anti-VASP antibody, (Red), compared to a nonspecific negative control antibody (Blue).
Western Blot: VASP Antibody (OTI4D6) [NBP2-00555] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY VASP (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-VASP.
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Nanos3 Antibody -
BSA Free
NBP1-76919
Immunocytochemistry/Immunofluorescence: Nanos3 Antibody [NBP1-76919] - in Human Brain cells.
Western Blot: Nanos3 Antibody [NBP1-76919] - Human brain tissue lysate with Nanos3 antibody at 2 ug/mL.
Immunohistochemistry-Paraffin: Nanos3 Antibody [NBP1-76919] - Human brain tissue with Nanos3 antibody at 2.5 ug/ml.
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
TNF-alpha
[Unconjugated]
210-TA/CF
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA/CF) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(702 Publications)
Species: Hu
Applications: BA
delta-Sarcoglycan
Antibody [Unconjugate ...
AF2778
delta-Sarcoglycan Antibody [Unconjugated]
Species: Hu
Applications: IHC, WB
Nanos2 Antibody -
BSA Free
NBP1-76917
Immunocytochemistry/Immunofluorescence: Nanos2 Antibody [NBP1-76917] - Immunofluorescence of Nanos2 in Human Testis cells with Nanos2 antibody at 20 ug/mL.
Western Blot: Nanos2 Antibody [NBP1-76917] - Rat brain tissue lysate with Nanos2 antibody at (A) 1 and (B) 2 ug/mL.
Immunohistochemistry-Paraffin: Nanos2 Antibody [NBP1-76917] - Human brain tissue cells with Nanos2 antibody at 2.5 ug/ml.
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
ALDH7A1 Antibody
NBP1-88908
Immunocytochemistry/Immunofluorescence: ALDH7A1 Antibody [NBP1-88908] - Staining of human cell line A-431 shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ALDH7A1 Antibody [NBP1-88908] - Analysis in human kidney and skeletal muscle tissues. Corresponding ALDH7A1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: ALDH7A1 Antibody [NBP1-88908] - Staining of human cerebral cortex shows moderate membranous positivity in microglia.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Calpain 3 Antibody
NBP1-31756
Immunocytochemistry/Immunofluorescence: Calpain 3 Antibody [NBP1-31756] - Analysis of methanol-fixed HeLa, using antibody at 1:200 dilution.
Western Blot: Calpain 3 Antibody [NBP1-31756] - Sample (30 ug of whole cell lysate) A: Molt-4 10% SDS PAGE; antibody diluted at 1:1000.
Species: Hu
Applications: ICC/IF, WB
PDE5A Antibody
NBP1-86139
Immunohistochemistry-Paraffin: PDE5A Antibody [NBP1-86139] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: PDE5A Antibody [NBP1-86139] - Staining of human prostate shows weak to moderate cytoplasmic positivity in smooth muscle cells.
Immunohistochemistry-Paraffin: PDE5A Antibody [NBP1-86139] - Staining of human duodenum shows weak to moderate cytoplasmic positivity in glandular cells.
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
beta Sarcoglycan
Antibody
NBP1-90300
beta Sarcoglycan Antibody
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for beta Sarcoglycan Antibody (NBP1-90300)(4)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 2 applications: IHC, WB.


Filter By Application
IHC
(1)
WB
(2)
All Applications
Filter By Species
Mouse
(3)
All Species

Reviews for beta Sarcoglycan Antibody (NBP1-90300) (0)

There are no reviews for beta Sarcoglycan Antibody (NBP1-90300). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for beta Sarcoglycan Antibody (NBP1-90300) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional beta Sarcoglycan Products

Bioinformatics Tool for beta Sarcoglycan Antibody (NBP1-90300)

Discover related pathways, diseases and genes to beta Sarcoglycan Antibody (NBP1-90300). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for beta Sarcoglycan Antibody (NBP1-90300)

Discover more about diseases related to beta Sarcoglycan Antibody (NBP1-90300).
 

Pathways for beta Sarcoglycan Antibody (NBP1-90300)

View related products by pathway.

PTMs for beta Sarcoglycan Antibody (NBP1-90300)

Learn more about PTMs related to beta Sarcoglycan Antibody (NBP1-90300).

Blogs on beta Sarcoglycan

There are no specific blogs for beta Sarcoglycan, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our beta Sarcoglycan Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol SGCB
Entrez
Uniprot