beta Sarcoglycan Antibody

Immunohistochemistry-Paraffin: beta Sarcoglycan Antibody [NBP1-90300] - Staining in human heart muscle and pancreas tissues using NBP1-90300 antibody. Corresponding SGCB RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: beta Sarcoglycan Antibody [NBP1-90300] - Staining of human heart muscle shows strong membranous and cytoplasmic positivity in cardiomyocytes.

Immunohistochemistry-Paraffin: beta Sarcoglycan Antibody [NBP1-90300] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Immunohistochemistry-Paraffin: beta Sarcoglycan Antibody [NBP1-90300] - Staining of human prostate shows very weak membranous positivity in smooth muscle cells.

Immunohistochemistry-Paraffin: beta Sarcoglycan Antibody [NBP1-90300] - Staining of human skeletal muscle shows moderate membranous positivity in myocytes.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

beta Sarcoglycan Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: FHMGGNMELKAENSIILNGSVMVSTTRLPSSSSGDQLGSGDWVRYKLCMCADGTLFKVQVTSQNMGCQISDNPCGNTH
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SGCB
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. WB use reported with previous lot in PMIDs: 28284983 and 26214262).
• Control Peptide:

  beta Sarcoglycan Protein (NBP1-90300PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (88%). Mouse reactivity reported in scientific literature (PMIDs : 29712757, 28284983, 26214262).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for beta Sarcoglycan Antibody

• 43 kDa dystrophin-associated glycoprotein
• 43DAG
• A3b
• A3bbeta-SG
• beta Sarcoglycan
• beta-Sarcoglycan
• beta-sarcoglycan(43kD dystrophin-associated glycoprotein)
• Beta-SG
• LGMD2E
• limb girdle muscular dystrophy 2E (non-linked families)
• Sarcoglycan beta
• sarcoglycan, beta (43kD dystrophin-associated glycoprotein)
• sarcoglycan, beta (43kDa dystrophin-associated glycoprotein)
• SGC
• SGCB

Background

The dystrophin-glycoprotein complex (DGC) is a multisubunit protein complex that spans the sarcolemma and provides structural linkage between the subsarcolemmal cytoskeleton and the extracellular matrix of muscle cells. There are 3 main subcomplexes of the DGC: the cytoplasmic proteins dystrophin (DMD; MIM 300377) and syntrophin (SNTA1; MIM 601017), the alpha- and beta-dystroglycans (see MIM 128239), and the sarcoglycans (see, e.g., SGCA; MIM 600119) (Crosbie et al., 2000 [PubMed 10942431]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for beta Sarcoglycan Antibody (NBP1-90300)(6)

Publications using NBP1-90300

• Baumann CW, Lindsay A, Sidky SR et al. Contraction-Induced Loss of Plasmalemmal Electrophysiological Function Is Dependent on the Dystrophin Glycoprotein Complex Frontiers in Physiology 2021-10-26 [PMID: 34764884] (WB, B/N)
• Sidky SR, Ingalls CP, Lowe DA, Baumann CW. Membrane Proteins Increase with the Repeated Bout Effect Medicine & Science in Sports & Exercise 2022-01-01 [PMID: 34334717] (B/N, WB)
• Brody MJ, Vanhoutte D, Schips TG et al. Defective Flux of Thrombospondin-4 through the Secretory Pathway Impairs Cardiomyocyte Membrane Stability and Causes Cardiomyopathy Mol. Cell. Biol. 2018-04-30 [PMID: 29712757] (Mouse)
• Pozsgai ER, Griffin DA, Heller KN et al. Systemic AAV-Mediated b-Sarcoglycan Delivery Targeting Cardiac and Skeletal Muscle Ameliorates Histological and Functional Deficits in LGMD2E Mice. Mol. Ther. 2017-03-08 [PMID: 28284983] (WB, Mouse)
• Vanhoutte D, Schips TG, Kwong JQ et al. Thrombospondin expression in myofibers stabilizes muscle membranes. Elife 2016-09-26 [PMID: 27669143] (IF/IHC)
• Pozsgai ER, Griffin DA, Heller KN et al. b-Sarcoglycan gene transfer decreases fibrosis and restores force in LGMD2E mice. Gene Ther. 2015-08-20 [PMID: 26214262] (WB, Mouse)

Bioinformatics

• Gene Symbol: SGCB
• Entrez:
  • 6443(Human)
• Uniprot:
  • Q16585(Human)