Orthogonal Strategies: Analysis in human heart muscle and pancreas tissues using NBP1-90300 antibody. Corresponding SGCB RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: beta Sarcoglycan Antibody [NBP1-90300] - Staining of human heart muscle shows strong membranous and cytoplasmic positivity in cardiomyocytes.
Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: beta Sarcoglycan Antibody [NBP1-90300] - Staining of human prostate shows very weak membranous positivity in smooth muscle cells.
Immunohistochemistry-Paraffin: beta Sarcoglycan Antibody [NBP1-90300] - Staining of human skeletal muscle shows moderate membranous positivity in myocytes.
Novus Biologicals Rabbit beta Sarcoglycan Antibody - BSA Free (NBP1-90300) is a polyclonal antibody validated for use in IHC and WB. Anti-beta Sarcoglycan Antibody: Cited in 7 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: FHMGGNMELKAENSIILNGSVMVSTTRLPSSSSGDQLGSGDWVRYKLCMCADGTLFKVQVTSQNMGCQISDNPCGNTH
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SGCB
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Immunogen displays the following percentage of sequence identity for non-tested species: Rat (88%). Mouse reactivity reported in scientific literature (PMIDs : 29712757, 28284983, 26214262).
Packaging, Storage & Formulations
Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified
Alternate Names for beta Sarcoglycan Antibody - BSA Free
The dystrophin-glycoprotein complex (DGC) is a multisubunit protein complex that spans the sarcolemma and provides structural linkage between the subsarcolemmal cytoskeleton and the extracellular matrix of muscle cells. There are 3 main subcomplexes of the DGC: the cytoplasmic proteins dystrophin (DMD; MIM 300377) and syntrophin (SNTA1; MIM 601017), the alpha- and beta-dystroglycans (see MIM 128239), and the sarcoglycans (see, e.g., SGCA; MIM 600119) (Crosbie et al., 2000 [PubMed 10942431]).[supplied by OMIM]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Reviews for beta Sarcoglycan Antibody (NBP1-90300) (0)
There are no reviews for beta Sarcoglycan Antibody (NBP1-90300).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our beta Sarcoglycan Antibody - BSA Free and receive a gift card or discount.