beta Sarcoglycan Antibody

Western Blot: beta Sarcoglycan Antibody [NBP1-90300] - Analysis in control (vector only transfected HEK293T lysate) and SGCB over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: beta Sarcoglycan Antibody [NBP1-90300] - Staining in human heart muscle and lymph node tissues using anti-SGCB antibody. Corresponding SGCB RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: beta Sarcoglycan Antibody [NBP1-90300] - Staining of human heart muscle shows high expression.

Immunohistochemistry-Paraffin: beta Sarcoglycan Antibody [NBP1-90300] - Staining of human lymph node shows low expression as expected.

• Reactivity: Hu, Mu
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

beta Sarcoglycan Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: FHMGGNMELKAENSIILNGSVMVSTTRLPSSSSGDQLGSGDWVRYKLCMCADGTLFKVQVTSQNMGCQISDNPCGNTH
• Specificity: Specificity of human, mouse beta Sarcoglycan antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SGCB
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Theoretical MW: 35 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  beta Sarcoglycan Protein (NBP1-90300PEP)

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 28284983). Expected species cross reactivity based on sequence homology: Rat (88%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for beta Sarcoglycan Antibody

• 43 kDa dystrophin-associated glycoprotein
• 43DAG
• A3b
• A3bbeta-SG
• beta Sarcoglycan
• beta-Sarcoglycan
• beta-sarcoglycan(43kD dystrophin-associated glycoprotein)
• Beta-SG
• LGMD2E
• limb girdle muscular dystrophy 2E (non-linked families)
• Sarcoglycan beta
• sarcoglycan, beta (43kD dystrophin-associated glycoprotein)
• sarcoglycan, beta (43kDa dystrophin-associated glycoprotein)
• SGC
• SGCB

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for beta Sarcoglycan Antibody (NBP1-90300)(3)

Publications using NBP1-90300

• Pozsgai ER, Griffin DA, Heller KN et al. Systemic AAV-Mediated b-Sarcoglycan Delivery Targeting Cardiac and Skeletal Muscle Ameliorates Histological and Functional Deficits in LGMD2E Mice. Mol. Ther. Mar 8 2017 [PMID: 28284983] (WB, Mouse)
• Vanhoutte D, Schips TG, Kwong JQ et al. Thrombospondin expression in myofibers stabilizes muscle membranes. Elife 2016 Sep 26 [PMID: 27669143] (IHC)
• Pozsgai ER, Griffin DA, Heller KN et al. b-Sarcoglycan gene transfer decreases fibrosis and restores force in LGMD2E mice. Gene Ther. 2015 Aug 20 [PMID: 26214262] (WB, Mouse)

Bioinformatics

• Gene Symbol: SGCB
• Entrez:
  • 6443(Human)
  • 24051(Mouse)
  • 680229(Rat)
• Uniprot:
  • Q16585(Human)