beta Sarcoglycan Antibody


Western Blot: beta Sarcoglycan Antibody [NBP1-90300] - Analysis in control (vector only transfected HEK293T lysate) and SGCB over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian more
Orthogonal Strategies: Immunohistochemistry-Paraffin: beta Sarcoglycan Antibody [NBP1-90300] - Staining in human heart muscle and lymph node tissues using anti-SGCB antibody. Corresponding SGCB RNA-seq data are more
Immunohistochemistry-Paraffin: beta Sarcoglycan Antibody [NBP1-90300] - Staining of human heart muscle shows high expression.
Immunohistochemistry-Paraffin: beta Sarcoglycan Antibody [NBP1-90300] - Staining of human lymph node shows low expression as expected.

Product Details

Reactivity Hu, MuSpecies Glossary
Applications WB, IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

beta Sarcoglycan Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: FHMGGNMELKAENSIILNGSVMVSTTRLPSSSSGDQLGSGDWVRYKLCMCADGTLFKVQVTSQNMGCQISDNPCGNTH
Specificity of human, mouse beta Sarcoglycan antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Theoretical MW
35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
beta Sarcoglycan Protein (NBP1-90300PEP)
Read Publications using
NBP1-90300 in the following applications:

  • IHC
    1 publication
  • WB
    2 publications

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 28284983). Expected species cross reactivity based on sequence homology: Rat (88%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for beta Sarcoglycan Antibody

  • 43 kDa dystrophin-associated glycoprotein
  • 43DAG
  • A3b
  • A3bbeta-SG
  • beta Sarcoglycan
  • beta-Sarcoglycan
  • beta-sarcoglycan(43kD dystrophin-associated glycoprotein)
  • Beta-SG
  • LGMD2E
  • limb girdle muscular dystrophy 2E (non-linked families)
  • Sarcoglycan beta
  • sarcoglycan, beta (43kD dystrophin-associated glycoprotein)
  • sarcoglycan, beta (43kDa dystrophin-associated glycoprotein)
  • SGC
  • SGCB


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, GP, Mk
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, IA, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for beta Sarcoglycan Antibody (NBP1-90300)(3)

Reviews for beta Sarcoglycan Antibody (NBP1-90300) (0)

There are no reviews for beta Sarcoglycan Antibody (NBP1-90300). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for beta Sarcoglycan Antibody (NBP1-90300) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional beta Sarcoglycan Products

Bioinformatics Tool for beta Sarcoglycan Antibody (NBP1-90300)

Discover related pathways, diseases and genes to beta Sarcoglycan Antibody (NBP1-90300). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for beta Sarcoglycan Antibody (NBP1-90300)

Discover more about diseases related to beta Sarcoglycan Antibody (NBP1-90300).

Pathways for beta Sarcoglycan Antibody (NBP1-90300)

View related products by pathway.

PTMs for beta Sarcoglycan Antibody (NBP1-90300)

Learn more about PTMs related to beta Sarcoglycan Antibody (NBP1-90300).

Blogs on beta Sarcoglycan

There are no specific blogs for beta Sarcoglycan, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our beta Sarcoglycan Antibody and receive a gift card or discount.


Gene Symbol SGCB