VAMP-7 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: VAMP-7 Antibody [NBP1-80709] - Immunofluorescent staining of human cell line U-251 MG shows localization to vesicles. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: VAMP-7 Antibody [NBP1-80709] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

VAMP-7 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit VAMP-7 Antibody - BSA Free (NBP1-80709) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-VAMP-7 Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: YAMNSEFSSVLAAQLKHHSENKGLDKVMETQAQVDELKGIMVRNIDLVAQRGERLELLIDKTENLVDSSVTFKTTSRNLARAMCMKNL
• Predicted Species: Mouse (98%), Rat (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: VAMP7
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: IHC reported in scientific literature (PMID: 24880616). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: PFA/Triton X-100.
• Control Peptide:

  VAMP-7 Protein (NBP1-80709PEP)

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 24880616).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for VAMP-7 Antibody - BSA Free

• FLJ54296
• SYBL1
• SYBL1FLJ53762
• synaptobrevin-like 1
• Synaptobrevin-like protein 1
• tetanus neurotoxin-insensitive VAMP
• Tetanus-insensitive VAMP
• TIVAMP
• TI-VAMP
• VAMP7
• VAMP-7
• VAMP-7FLJ53045
• vesicle-associated membrane protein 7

Background

Involved in the targeting and/or fusion of transport vesicles to their target membrane during transport of proteins from the early endosome to the lysosome. Required for heterotypic fusion of late endosomes with lysosomes and homotypic lysosomal fusion. Required for calcium regulated lysosomal exocytosis. Involved in the export of chylomicrons from the endoplasmic reticulum to the cis Golgi. Required for exocytosis of mediators during eosinophil and neutrophil degranulation, and target cell killing by natural killer cells. Required for focal exocytosis of late endocytic vesicles during phagosome formation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for VAMP-7 Antibody (NBP1-80709)(3)

Publications using NBP1-80709

• Hallam RD, Buchner-Duby B, Stykel MG et al. Intracellular Accumulation of alpha -Synuclein Aggregates Promotes S-Nitrosylation of MAP1A Leading to Decreased NMDAR-Evoked Calcium Influx and Loss of Mature Synaptic Spines The Journal of neuroscience : the official journal of the Society for Neuroscience 2022-11-11 [PMID: 36414406]
• Hu X, Zhang R, Liang H et al. Comparison and Investigation of Exosomes from Human Amniotic Fluid Stem Cells and Human Breast Milk in Alleviating Neonatal Necrotizing Enterocolitis Stem cell reviews and reports 2022-11-16 [PMID: 36385400] (IHC-P, Mouse)
  
  Details:
  Dilution used in IHC-P 1:2000
• Tannour-Louet M, Han S, Louet JF et al. Increased gene copy number of the vesicle SNARE VAMP7 disrupts human male urogenital development through altered estrogen action. Nat Med 2014-07-01 [PMID: 24880616] (IF/IHC, Human)

Bioinformatics

• Gene Symbol: VAMP7
• Entrez:
  • 6845(Human)
• Uniprot:
  • P51809(Human)