VAMP-5 Antibody - BSA Free

Immunohistochemistry-Paraffin: VAMP-5 Antibody [NBP1-85913] - Staining of human prostate shows strong granular cytoplasmic positivity in glandular cells.

Staining of human pancreas shows strong cytoplasmic granular positivity in exocrine glandular cells.

Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.

Staining of human kidney shows strong membranous positivity in cells in glomeruli.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

VAMP-5 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit VAMP-5 Antibody - BSA Free (NBP1-85913) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MAGIELERCQQQANEVTEIMRNNFGKVLERGVKLAELQQRSDQLLDMSSTFNKTTQNLAQKKCWENIRYR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: VAMP5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  VAMP-5 Protein (NBP1-85913PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for VAMP-5 Antibody - BSA Free

• Myobrevin
• VAMP5
• VAMP-5
• vesicle-associated membrane protein 5 (myobrevin)
• vesicle-associated membrane protein 5

Background

Synaptobrevins/VAMPs, syntaxins, and the 25-kD synaptosomal-associated protein are the main components of a protein complex involved in the docking and/or fusion of vesicles and cell membranes. The VAMP5 gene is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family and the SNARE superfamily. This VAMP family member may participate in vesicle trafficking events that are associated with myogenesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: VAMP5