VAMP4 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: VAMP4 Antibody [NBP2-13512] - Immunofluorescent staining of human cell line A-431 shows localization to the Golgi apparatus.
Immunohistochemistry-Paraffin: VAMP4 Antibody [NBP2-13512] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

VAMP4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MPPKFKRHLNDDDVTGSVKSERRNLLEDDSDEEEDFFLRGPSGPRFGPRN DK
Marker
Vesicle Marker, Golgi Apparatus Marker
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
VAMP4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
VAMP4 Protein (NBP2-13512PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for VAMP4 Antibody

  • VAMP24
  • VAMP-4
  • vesicle-associated membrane protein 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5664
Species: Hu
Applications: WB, IHC, ICC
NB300-510
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF
NBP2-00795
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB300-595
Species: Mu, Rt, Bv
Applications: WB, Flow, IHC, IHC-P, IP, IF
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBP1-83162
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
MAB6117
Species: Hu
Applications: WB, IHC
NBP1-92467
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-87439
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF5687
Species: Hu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP2-13408
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00079026-M01
Species: Hu
Applications: WB, ELISA, IP
NBP1-80883
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45413
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IHC
NBP1-49643
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13512
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for VAMP4 Antibody (NBP2-13512) (0)

There are no publications for VAMP4 Antibody (NBP2-13512).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VAMP4 Antibody (NBP2-13512) (0)

There are no reviews for VAMP4 Antibody (NBP2-13512). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for VAMP4 Antibody (NBP2-13512) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional VAMP4 Products

Bioinformatics Tool for VAMP4 Antibody (NBP2-13512)

Discover related pathways, diseases and genes to VAMP4 Antibody (NBP2-13512). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VAMP4 Antibody (NBP2-13512)

Discover more about diseases related to VAMP4 Antibody (NBP2-13512).
 

Pathways for VAMP4 Antibody (NBP2-13512)

View related products by pathway.

PTMs for VAMP4 Antibody (NBP2-13512)

Learn more about PTMs related to VAMP4 Antibody (NBP2-13512).
 

Research Areas for VAMP4 Antibody (NBP2-13512)

Find related products by research area.

Blogs on VAMP4

There are no specific blogs for VAMP4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our VAMP4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol VAMP4