VAMP4 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: VAMP4 Antibody [NBP2-13512] - Staining of human cell line A-431 shows localization to the Golgi apparatus. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: VAMP4 Antibody [NBP2-13512] - Staining of human cerebral cortex shows strong granular cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: VAMP4 Antibody [NBP2-13512] - Staining of human endometrium shows moderate granular cytoplasmic positivity in glandular cells

Immunohistochemistry-Paraffin: VAMP4 Antibody [NBP2-13512] - Staining of human skeletal muscle shows weak positivity in myocytes.

Immunohistochemistry-Paraffin: VAMP4 Antibody [NBP2-13512] - Analysis in human cerebral cortex and skeletal muscle tissues. Corresponding VAMP4 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: VAMP4 Antibody [NBP2-13512] - Staining of human cerebellum shows moderate granular cytoplasmic positivity in Purkinje cells.

Staining of human endometrium shows moderate granular cytoplasmic positivity in glandular cells.

Analysis in human cerebral cortex and skeletal muscle tissues using NBP2-13512 antibody. Corresponding VAMP4 RNA-seq data are presented for the same tissues.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

VAMP4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit VAMP4 Antibody - BSA Free (NBP2-13512) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-VAMP4 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: MPPKFKRHLNDDDVTGSVKSERRNLLEDDSDEEEDFFLRGPSGPRFGPRNDK
• Marker: Vesicle Marker, Golgi Apparatus Marker
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: VAMP4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  VAMP4 Protein (NBP2-13512PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for VAMP4 Antibody - BSA Free

• VAMP24
• VAMP-4
• vesicle-associated membrane protein 4

Background

The vesicle associated membrane proteins (VAMP) or synaptobrevins are calcium binding proteins specific to eukaryotes. VAMPs, along with synaptosomal associated protein of 25 kDa (SNAP 25) and syntaxin, form the core complex of soluble NSF attachment protein receptor (SNARE) proteins that interact with the soluble proteins N-ethylmaleimide-sensitive factor (NSF) and alpha-SNAP. These membrane associated proteins play a key role in the regulation of vesicle membrane fusion with the plasma membrane. The Clostridium tetani neurotoxin is a metalloprotease with specificity for VAMP. In Alzheimer®s disease, VAMP levels of all isoforms appear to be significantly lowered.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for VAMP4 Antibody (NBP2-13512)(1)

Publication using NBP2-13512

• Gu Y, Princely Y, Kumar S et al. Mammalian Atg8 proteins regulate lysosome and autolysosome biogenesis through SNAREs. EMBO J. 2019-10-18 [PMID: 31625181]

Bioinformatics

• Gene Symbol: VAMP4