UXT Antibody

Images

 
Western Blot: UXT Antibody [H00008409-B01P] - Analysis of UXT expression in Jurkat.
Immunocytochemistry/ Immunofluorescence: UXT Antibody [H00008409-B01P] - Analysis of purified antibody to UXT on HeLa cell. (antibody concentration 10 ug/ml)
Western Blot: UXT Antibody [H00008409-B01P] - Analysis of UXT expression in transfected 293T cell line by UXT polyclonal antibody. Lane 1: UXT transfected lysate(18.59 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

UXT Antibody Summary

Immunogen
UXT (NP_705582.1, 1 a.a. - 169 a.a.) full-length human protein. MVFPLPTPQEPIMATPPKRRAVEATGEKVLRYETFISDVLQRDLRKVLDHRDKVYEQLAKYLQLRNVIERLQEAKHSELYMQVDLGCNFFVDTVVPDTSRIYVALGYGFFLELTLAEALKFIDRKSSLLTELSNSLTKDSMNIKAHIHMLLEGLRELQGLQNFPEKPHH
Specificity
Reacts with ubiquitously-expressed transcript.
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
UXT
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence
Application Notes
This antibody is reactive against transfected lysate in WB and as a detection antibody in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for UXT Antibody

  • Androgen receptor trapped clone 27 protein
  • ART-27protein UXT
  • SKP2-associated alpha PFD 1
  • STAP1
  • Ubiquitously expressed transcript protein
  • ubiquitously-expressed transcript

Background

This gene encodes a novel protein which is highly conserved in mouse. It interacts with the N-terminus of the androgen receptor and plays a role in facilitating receptor-induced transcriptional activation. It is also likely to be involved in tumorigenesis as it is abundantly expressed in tumor tissues. This gene is part of a gene cluster on chromosome Xp11.23. Alternative splicing results in 2 transcript variants encoding different isoforms. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-79413
Species: Hu
Applications: WB
NB200-310
Species: Hu, Mu, Rt, Mk
Applications: WB, ChIP, IP, IF
NB600-501
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, Fi, GP, Ha, Le, Ma, Pm, Rb, Sh, Sq, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-64792
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
NBP2-19428
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-32744
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92351
Species: Hu
Applications: IHC, IHC-P
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-86815
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
NBP2-22380
Species: Hu
Applications: WB, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
H00008409-B01P
Species: Hu
Applications: WB, ICC/IF

Publications for UXT Antibody (H00008409-B01P) (0)

There are no publications for UXT Antibody (H00008409-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UXT Antibody (H00008409-B01P) (0)

There are no reviews for UXT Antibody (H00008409-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for UXT Antibody (H00008409-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional UXT Products

Bioinformatics Tool for UXT Antibody (H00008409-B01P)

Discover related pathways, diseases and genes to UXT Antibody (H00008409-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UXT Antibody (H00008409-B01P)

Discover more about diseases related to UXT Antibody (H00008409-B01P).
 

Pathways for UXT Antibody (H00008409-B01P)

View related products by pathway.

PTMs for UXT Antibody (H00008409-B01P)

Learn more about PTMs related to UXT Antibody (H00008409-B01P).

Blogs on UXT

There are no specific blogs for UXT, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UXT Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UXT
Entrez
Uniprot