UTP3 Antibody - BSA Free

Western Blot: UTP3 Antibody [NBP2-58960] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.

Immunocytochemistry/Immunofluorescence: UTP3 Antibody [NBP2-58960] - Staining of human cell line U-2 OS shows localization to nucleoli.

• Reactivity: Hu, Mu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

UTP3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit UTP3 Antibody - BSA Free (NBP2-58960) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LNYCSNISFYLILKARRVPAHGHPVIERLVTYRNLINKLSVVDQKLSSEIRHLLTLKDDAVKKELIPKAKSTKPK
• Predicted Species: Mouse (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: UTP3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  UTP3 Recombinant Protein Antigen (NBP2-58960PEP)

Reactivity Notes

Rat 88%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for UTP3 Antibody - BSA Free

• Charged amino acid-rich leucine zipper 1
• CRL1charged amino acid rich leucine zipper 1 homolog
• CRLZ1UTP3 homolog
• disrupter of silencing 10
• Disrupter of silencing SAS10
• FLJ23256
• SAS10DKFZp761F222
• something about silencing protein 10
• UTP3, small subunit (SSU) processome component, homolog (S. cerevisiae)

Background

SAS10 (something about silencing 10) was originally identified in a screen for yeast genes that distrupted gene silencing when overexpressed . Alternative names for SAS10 include UTP3 homolog, disrupter of silencing SAS10, charged amino acid-rich leucine zipper 1, and CRLZ1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: UTP3