UTP3 Antibody

Images

 
Western Blot: UTP3 Antibody [NBP2-58960] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunocytochemistry/ Immunofluorescence: UTP3 Antibody [NBP2-58960] - Staining of human cell line U-2 OS shows localization to nucleoli.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

UTP3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LNYCSNISFYLILKARRVPAHGHPVIERLVTYRNLINKLSVVDQKLSSEIRHLLTLKDDAVKKELIPKAKSTKPK
Specificity
Specificity of human UTP3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UTP3
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
UTP3 Recombinant Protein Antigen (NBP2-58960PEP)

Reactivity Notes

Rat 88%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for UTP3 Antibody

  • Charged amino acid-rich leucine zipper 1
  • CRL1charged amino acid rich leucine zipper 1 homolog
  • CRLZ1UTP3 homolog
  • disrupter of silencing 10
  • Disrupter of silencing SAS10
  • FLJ23256
  • SAS10DKFZp761F222
  • something about silencing protein 10
  • UTP3, small subunit (SSU) processome component, homolog (S. cerevisiae)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2769
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-16669
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-40840
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-88502
Species: Hu
Applications: IHC, IHC-P
MAB1207
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB600-335
Species: Hu, Mu, Ec, All-NA
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-91269
Species: Hu, Mu
Applications: ICC/IF (-), IHC (-), WB
H00051176-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, PLA, RNAi, S-ELISA
H00010438-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP2-47560
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-64808
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-Fr, IP, IF
NBP1-59631
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00001879-M02
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IP, RNAi, S-ELISA
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-106
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-2567
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-75458
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF944
Species: Hu
Applications: WB, IHC

Publications for UTP3 Antibody (NBP2-58960) (0)

There are no publications for UTP3 Antibody (NBP2-58960).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UTP3 Antibody (NBP2-58960) (0)

There are no reviews for UTP3 Antibody (NBP2-58960). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for UTP3 Antibody (NBP2-58960) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional UTP3 Products

Bioinformatics Tool for UTP3 Antibody (NBP2-58960)

Discover related pathways, diseases and genes to UTP3 Antibody (NBP2-58960). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on UTP3

There are no specific blogs for UTP3, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UTP3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UTP3